Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human KLK3 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P07288
Molecular weight:
26.92 kDa

Original price was: $295.00.Current price is: $244.00.

20ug 17% OFF + 244 loyalty points
Partial Yes
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human KLK3 Recombinant Protein

Human KLK3 Recombinant Protein

Product name Human KLK3 Recombinant Protein
Uniprot ID P07288
Uniprot link http://www.uniprot.org/uniprot/P07288
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Molecular weight 26.92 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference P07288
Aliases /Synonyms Kallikrein 3,KLK3, APS, KLK2A1, PSA, HK3, KLKB1, Seminin, Prostate Specific Antigen, Kallikrein-Related Peptidase 3, Semenogelase, g-Seminoprotein, P-30 Antigen, Plasma kallikrein
Reference PX-P3045
Note For research use only
Molecular Constructor
Partial Yes
Product name Human KLK3 Recombinant Protein
Uniprot ID P07288
Uniprot link http://www.uniprot.org/uniprot/P07288
Origin species Homo sapiens (Human)
Expression system Procaryotic expression
Raw Antigen Sequence IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Molecular weight 26.92 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference P07288
Aliases /Synonyms Kallikrein 3,KLK3, APS, KLK2A1, PSA, HK3, KLKB1, Seminin, Prostate Specific Antigen, Kallikrein-Related Peptidase 3, Semenogelase, g-Seminoprotein, P-30 Antigen, Plasma kallikrein
Reference PX-P3045
Note For research use only
Molecular Constructor
Partial Yes
Product name Human KLK3 Recombinant Protein
Uniprot ID P07288
Uniprot link http://www.uniprot.org/uniprot/P07288
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Molecular weight 26.92 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference P07288
Aliases /Synonyms Kallikrein 3,KLK3, APS, KLK2A1, PSA, HK3, KLKB1, Seminin, Prostate Specific Antigen, Kallikrein-Related Peptidase 3, Semenogelase, g-Seminoprotein, P-30 Antigen, Plasma kallikrein
Reference PX-P3045
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P3045-1MG
Uniprot ID P07288
Uniprot link http://www.uniprot.org/uniprot/P07288
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Molecular weight 26.92 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference P07288
Aliases /Synonyms Kallikrein 3,KLK3, APS, KLK2A1, PSA, HK3, KLKB1, Seminin, Prostate Specific Antigen, Kallikrein-Related Peptidase 3, Semenogelase, g-Seminoprotein, P-30 Antigen, Plasma kallikrein
Reference PX-P3045
Note For research use only
Molecular Constructor
Partial Yes

Human KLK3 Recombinant Protein

There are no reviews yet.

Be the first to review “Human KLK3 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products