Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human ROR2 recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q01974
Molecular weight:
53.30 kDa

$392.00

100ug + 392 loyalty points
His Trp683–Thr923
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human ROR2 recombinant protein

Product name Human ROR2 recombinant protein
Uniprot ID Q01974
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence WEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAWVYALMIECWNEFPSRRPRFKDIHSRLRAWGNLSNYNSSAQTSGASNTTQTSSLSTSPVSNVSNARYVGPKQKAPPFPQPQFIPMKGQIRPMVPPPQLYVPVNGYQPVPAYGAYLPNFYPVQIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNAPEDGAQSTVQEAEEEEEGSVPET
Molecular weight 53.30 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Trp683-Thr923
Aliases /Synonyms ROR2, Neurotrophic tyrosine kinase, receptor-related 2, NTRKR2, Tyrosine-protein kinase transmembrane receptor ROR2
Reference PX-P6047
Note For research use only
Molecular Constructor
His Trp683–Thr923

Human ROR2 recombinant protein

There are no reviews yet.

Be the first to review “Human ROR2 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products