Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

InVivoMAb Anti-Human CXCL10/IP-10 (Iv0088)

  • ARO-A13287-100
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: $606.00.Current price is: $436.00.

100ug 28% OFF + 436 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

InVivoMAb Anti-Human CXCL10/IP-10 (Iv0088)

Product name ARO-A13287-100
Uniprot ID P02778
Raw Antigen Sequence MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Gamma-IP10, C-X-C motif chemokine 10, INP10, 10 kDa interferon gamma-induced protein, Small-inducible cytokine B10, SCYB10, IP-10, CXCL10
Reference ARO-A13287
Clonality Monoclonal Antibody
Protein Name Gamma-IP10
Product name ARO-A13287-1MG
Uniprot ID P02778
Raw Antigen Sequence MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Gamma-IP10, C-X-C motif chemokine 10, INP10, 10 kDa interferon gamma-induced protein, Small-inducible cytokine B10, SCYB10, IP-10, CXCL10
Reference ARO-A13287
Clonality Monoclonal Antibody
Protein Name Gamma-IP10
Product name ARO-A13287-50
Uniprot ID P02778
Raw Antigen Sequence MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Gamma-IP10, C-X-C motif chemokine 10, INP10, 10 kDa interferon gamma-induced protein, Small-inducible cytokine B10, SCYB10, IP-10, CXCL10
Reference ARO-A13287
Clonality Monoclonal Antibody
Protein Name Gamma-IP10

InVivoMAb Anti-Human CXCL10/IP-10 (Iv0088) binds to Human CXCL10/IP-10 Recombinant Protein, N-GST & C-His in WB Assay

InVivoMAb Anti-Human CXCL10/IP-10 (Iv0088) binds to Human CXCL10/IP-10 Recombinant Protein, N-GST & C-His in WB Assay

Human CXCL10/IP-10 Recombinant Protein, N-GST & C-His(cat. No.ARO-P21254) can bind InVivoMAb Anti-Human CXCL10/IP-10 (Iv0088) in Western Blot Assay as detected on gel analysis.

SDS-PAGE for InVivoMAb Anti-Human CXCL10/IP-10 (Iv0088)

SDS-PAGE for InVivoMAb Anti-Human CXCL10/IP-10 (Iv0088)

InVivoMAb Anti-Human CXCL10/IP-10 (Iv0088), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human CXCL10/IP-10 (Iv0088)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products