Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

InVivoMAb Anti-Mouse ANGPTL4 Antibody (4A8)

Clonality:
Monoclonal Antibody
Host species:
Mouse

Original price was: $570.00.Current price is: $436.00.

100ug 24% OFF + 436 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for InVivoMAb Anti-Mouse ANGPTL4 Antibody (4A8)

InVivoMAb Anti-Mouse ANGPTL4 Antibody (4A8)

Product name ARO-A13020-100
Uniprot ID Q9Z1P8
Raw Antigen Sequence MRCAPTAGAALVLCAATAGLLSAQGRPAQPEPPRFASWDEMNLLAHGLLQLGHGLREHVERTRGQLGALERRMAACGNACQGPKGKDAPFKDSEDRVPEGQTPETLQSLQTQLKAQNSKIQQLFQKVAQQQRYLSKQNLRIQNLQSQIDLLAPTHLDNGVDKTSRGKRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-Angiopoietin-related protein 4, 425O18-1, Angiopoietin-like protein 4, Fasting-induced adipose factor, Hepatic fibrinogen/angiopoietin-related protein, HFARP, Secreted protein Bk89, ANGPTL4 N-terminal chain, ANGPTL4 C-terminal chain, Angptl4, Farp, Fiaf, Ng27
Reference ARO-A13020
Clonality Monoclonal Antibody
Protein Name Angiopoietin-related protein 4
Product name ARO-A13020-1MG
Uniprot ID Q9Z1P8
Raw Antigen Sequence MRCAPTAGAALVLCAATAGLLSAQGRPAQPEPPRFASWDEMNLLAHGLLQLGHGLREHVERTRGQLGALERRMAACGNACQGPKGKDAPFKDSEDRVPEGQTPETLQSLQTQLKAQNSKIQQLFQKVAQQQRYLSKQNLRIQNLQSQIDLLAPTHLDNGVDKTSRGKRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-Angiopoietin-related protein 4, 425O18-1, Angiopoietin-like protein 4, Fasting-induced adipose factor, Hepatic fibrinogen/angiopoietin-related protein, HFARP, Secreted protein Bk89, ANGPTL4 N-terminal chain, ANGPTL4 C-terminal chain, Angptl4, Farp, Fiaf, Ng27
Reference ARO-A13020
Clonality Monoclonal Antibody
Protein Name Angiopoietin-related protein 4
Product name ARO-A13020-50
Uniprot ID Q9Z1P8
Raw Antigen Sequence MRCAPTAGAALVLCAATAGLLSAQGRPAQPEPPRFASWDEMNLLAHGLLQLGHGLREHVERTRGQLGALERRMAACGNACQGPKGKDAPFKDSEDRVPEGQTPETLQSLQTQLKAQNSKIQQLFQKVAQQQRYLSKQNLRIQNLQSQIDLLAPTHLDNGVDKTSRGKRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-Angiopoietin-related protein 4, 425O18-1, Angiopoietin-like protein 4, Fasting-induced adipose factor, Hepatic fibrinogen/angiopoietin-related protein, HFARP, Secreted protein Bk89, ANGPTL4 N-terminal chain, ANGPTL4 C-terminal chain, Angptl4, Farp, Fiaf, Ng27
Reference ARO-A13020
Clonality Monoclonal Antibody
Protein Name Angiopoietin-related protein 4

SDS-PAGE for InVivoMAb Anti-Mouse ANGPTL4 Antibody (4A8)

SDS-PAGE for InVivoMAb Anti-Mouse ANGPTL4 Antibody (4A8)

InVivoMAb Anti-Mouse ANGPTL4 Antibody (4A8), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Mouse ANGPTL4 Antibody (4A8)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products