Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Mouse ANGPTL4 Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9Z1P8

Original price was: $476.00.Current price is: $387.00.

100ug 19% OFF + 387 loyalty points
His Thr183–Ser410
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Mouse ANGPTL4 Recombinant Protein, N-His

Mouse ANGPTL4 Recombinant Protein, N-His

Product name ARO-P17944-100
Uniprot ID Q9Z1P8
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence THLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr183-Ser410
Aliases /Synonyms Angiopoietin-related protein 4, 425O18-1, Angiopoietin-like protein 4, Fasting-induced adipose factor, Hepatic fibrinogen/angiopoietin-related protein, HFARP, Secreted protein Bk89, ANGPTL4 N-terminal chain, ANGPTL4 C-terminal chain, Angptl4, Farp, Fiaf, Ng27
Reference ARO-P17944
Note For research use only.
Molecular Constructor
His Thr183–Ser410
Product name ARO-P17944-1MG
Uniprot ID Q9Z1P8
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence THLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr183-Ser410
Aliases /Synonyms Angiopoietin-related protein 4, 425O18-1, Angiopoietin-like protein 4, Fasting-induced adipose factor, Hepatic fibrinogen/angiopoietin-related protein, HFARP, Secreted protein Bk89, ANGPTL4 N-terminal chain, ANGPTL4 C-terminal chain, Angptl4, Farp, Fiaf, Ng27
Reference ARO-P17944
Note For research use only.
Molecular Constructor
His Thr183–Ser410
Product name ARO-P17944-50
Uniprot ID Q9Z1P8
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence THLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr183-Ser410
Aliases /Synonyms Angiopoietin-related protein 4, 425O18-1, Angiopoietin-like protein 4, Fasting-induced adipose factor, Hepatic fibrinogen/angiopoietin-related protein, HFARP, Secreted protein Bk89, ANGPTL4 N-terminal chain, ANGPTL4 C-terminal chain, Angptl4, Farp, Fiaf, Ng27
Reference ARO-P17944
Note For research use only.
Molecular Constructor
His Thr183–Ser410

There are no reviews yet.

Be the first to review “Mouse ANGPTL4 Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products