Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Leronlimab Biosimilar – Anti-CCR5, CD195 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $302.00.Current price is: $238.00.

100ug 21% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Leronlimab Biosimilar - Anti-CCR5, CD195 mAb - Research Grade

Product name Leronlimab Biosimilar - Anti-CCR5, CD195 mAb - Research Grade
Uniprot ID P51681
Source CAS 674782-26-4
Species Humanized
Raw Antigen Sequence MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Leronlimab,HuPRO-140,PA-14,PRO-140,CCR5, CD195,anti-CCR5, CD195
Reference PX-TA1511
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Leronlimab Biosimilar - Anti-CCR5, CD195 mAb - Research Grade
Uniprot ID P51681
Source CAS 674782-26-4
Species Humanized
Raw Antigen Sequence MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Leronlimab,HuPRO-140,PA-14,PRO-140,CCR5, CD195,anti-CCR5, CD195
Reference PX-TA1511
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1511-50
Uniprot ID P51681
Source CAS 674782-26-4
Species Humanized
Raw Antigen Sequence MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Leronlimab,HuPRO-140,PA-14,PRO-140,CCR5, CD195,anti-CCR5, CD195
Reference PX-TA1511
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Leronlimab Biosimilar: A Promising Anti-CCR5 Antibody for Therapeutic Targeting of CD195 Leronlimab Biosimilar, also known as PRO 140, is a novel monoclonal antibody (mAb) that targets the C-C chemokine receptor type 5 (CCR5) protein. CCR5 is a cell surface receptor that plays a crucial role in various physiological and pathological processes, including immune response, inflammation, and viral infection. Leronlimab Biosimilar has shown promising results in preclinical and clinical studies as a potential therapeutic agent for a wide range of diseases, making it a highly sought-after antibody in the field of biotechnology.

Structure of Leronlimab Biosimilar

Leronlimab Biosimilar is a humanized IgG4 mAb that is derived from the original PRO 140 antibody. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region of the antibody is responsible for binding to its target, while the constant region determines the effector functions of the antibody.

The binding site of Leronlimab Biosimilar is located in the variable region of the heavy chain, specifically in the complementarity-determining regions (CDRs). These regions are highly diverse and allow the antibody to recognize and bind to its target with high specificity. The CDRs of Leronlimab Biosimilar have been engineered to have a strong affinity for CCR5, making it a potent inhibitor of CCR5 signaling.

Mechanism of Action

Leronlimab Biosimilar exerts its therapeutic effects by blocking the interaction between CCR5 and its ligands, such as chemokines and viral proteins. CCR5 is primarily expressed on the surface of immune cells, including T cells, macrophages, and dendritic cells. Upon activation, CCR5 mediates the recruitment and activation of these cells at sites of inflammation or infection.

By binding to CCR5, Leronlimab Biosimilar prevents the binding of its ligands, thus inhibiting the recruitment and activation of immune cells. This leads to a decrease in inflammation and immune response, making it an effective treatment for various inflammatory and autoimmune diseases. Moreover, by blocking CCR5, Leronlimab Biosimilar also prevents the entry of HIV into host cells, making it a potential therapeutic agent for HIV infection.

Applications of Leronlimab Biosimilar

Leronlimab Biosimilar has shown promising results in preclinical and clinical studies as a potential treatment for various diseases. Its main applications include:

  • Inflammatory Diseases: Leronlimab Biosimilar has been shown to be effective in treating inflammatory diseases such as rheumatoid arthritis, psoriasis, and multiple sclerosis. By inhibiting CCR5 signaling, it reduces inflammation and provides relief from symptoms.
  • HIV Infection: As a potent inhibitor of CCR5, Leronlimab Biosimilar has shown promising results in clinical trials for the treatment of HIV infection. It has been shown to decrease viral load and increase CD4+ T cell counts in HIV-infected individuals.
  • Cancer: CCR5 has been found to be overexpressed in various types of cancer, including breast, lung, and pancreatic cancer. Leronlimab Biosimilar has shown potential as a cancer therapy by inhibiting CCR5 signaling and reducing tumor growth and metastasis.
  • COVID-19: Leronlimab Biosimilar has recently gained attention as a potential treatment for COVID-19. By inhibiting CCR5, it may prevent the cytokine storm and immune dysregulation that is seen in severe cases of COVID-19.

Conclusion Leronlimab Biosimilar, a novel anti-CCR5

SDS-PAGE for Leronlimab Biosimilar - Anti-CCR5; CD195 mAb - Research Grade

SDS-PAGE for Leronlimab Biosimilar - Anti-CCR5; CD195 mAb - Research Grade

Leronlimab Biosimilar - Anti-CCR5; CD195 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Leronlimab Biosimilar - Anti-CCR5, CD195 mAb - Research Grade

There are no reviews yet.

Be the first to review “Leronlimab Biosimilar – Anti-CCR5, CD195 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products