Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Linclatamig Biosimilar – Anti-MEGT1;CD3e mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $217.00.Current price is: $167.00.

50ug 23% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Linclatamig Biosimilar - Anti-MEGT1;CD3e mAb - Research Grade

Product name PX-TA2197-50
Uniprot ID O95868 & P07766
Source Bispecific, CAS: 2885203-43-8
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MKPQFVGILLSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNSAVASHVAPAGILAAAATALTCLLPGLWSG
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-MEGT1, G6D, Megakaryocyte-enhanced gene transcript 1 protein, NG25, LY6G6D, C6orf23, Protein Ly6-D, Lymphocyte antigen 6 complex locus protein G6d, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA2197-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Linclatamig Biosimilar - Anti-MEGT1;CD3e mAb - Research Grade
Uniprot ID O95868 & P07766
Source Bispecific, CAS: 2885203-43-8
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MKPQFVGILLSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNSAVASHVAPAGILAAAATALTCLLPGLWSG
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-MEGT1, G6D, Megakaryocyte-enhanced gene transcript 1 protein, NG25, LY6G6D, C6orf23, Protein Ly6-D, Lymphocyte antigen 6 complex locus protein G6d, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA2197-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Linclatamig Biosimilar - Anti-MEGT1;CD3e mAb - Research Grade
Uniprot ID O95868 & P07766
Source Bispecific, CAS: 2885203-43-8
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MKPQFVGILLSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNSAVASHVAPAGILAAAATALTCLLPGLWSG
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-MEGT1, G6D, Megakaryocyte-enhanced gene transcript 1 protein, NG25, LY6G6D, C6orf23, Protein Ly6-D, Lymphocyte antigen 6 complex locus protein G6d, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA2197-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Linclatamig Biosimilar – Anti-MEGT1;CD3e mAb – Research Grade is a therapeutic antibody that has been developed as a biosimilar to the existing therapeutic antibody, Linclatamig. This biosimilar is specifically designed to target the MEGT1 protein, which is a therapeutic target that has been implicated in various diseases. In this article, we will discuss the structure, activity, and application of Linclatamig Biosimilar – Anti-MEGT1;CD3e mAb – Research Grade in detail.

Structure of Linclatamig Biosimilar

Linclatamig Biosimilar – Anti-MEGT1;CD3e mAb – Research Grade is a monoclonal antibody (mAb) that is produced by recombinant DNA technology. It is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains are approximately 150 kDa in size, while the light chains are approximately 25 kDa. The antibody has a Y-shaped structure, with two antigen-binding fragments (Fab) and one crystallizable fragment (Fc).

Activity of Linclatamig Biosimilar

Linclatamig Biosimilar – Anti-MEGT1;CD3e mAb – Research Grade specifically targets the MEGT1 protein, which is a cell surface receptor that is expressed on various types of cells, including T cells and natural killer (NK) cells. The binding of the antibody to MEGT1 triggers a series of downstream signaling events, leading to the activation of these immune cells. This activation results in the destruction of target cells, such as cancer cells or infected cells, through various mechanisms, including antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Application of Linclatamig Biosimilar

Linclatamig Biosimilar – Anti-MEGT1;CD3e mAb – Research Grade has a wide range of applications in the field of immunotherapy. It has been primarily developed for the treatment of various types of cancers, including hematological malignancies and solid tumors. The antibody has shown promising results in preclinical and clinical studies, demonstrating its potential as a targeted therapy for cancer.

In addition to cancer, Linclatamig Biosimilar – Anti-MEGT1;CD3e mAb – Research Grade has also shown potential in the treatment of autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis. By targeting the MEGT1 protein, the antibody can modulate the immune response and reduce inflammation, providing a potential treatment option for these conditions.

Furthermore, Linclatamig Biosimilar – Anti-MEGT1;CD3e mAb – Research Grade has also been investigated for its potential in the prevention of organ transplant rejection. By targeting MEGT1, the antibody can inhibit the activation of T cells, which play a crucial role in organ rejection. This could potentially improve the success rate of organ transplants and reduce the need for immunosuppressive drugs.

Conclusion

In conclusion, Linclatamig Biosimilar – Anti-MEGT1;CD3e mAb – Research Grade is a promising therapeutic antibody that specifically targets the MEGT1 protein. Its unique structure and activity make it a potential treatment option for a wide range of diseases, including cancer, autoimmune diseases, and organ transplant rejection. Further research and clinical trials are needed to fully understand the potential of this biosimilar and its role in improving patient outcomes.

SDS-PAGE for Linclatamig Biosimilar - Research Grade

SDS-PAGE for Linclatamig Biosimilar - Research Grade

Linclatamig Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Linclatamig Biosimilar – Anti-MEGT1;CD3e mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products