Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rinatabart Biosimilar – Anti-Folate receptor alpha mAb – Research Grade

  • PX-TA2207-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $228.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Rinatabart Biosimilar - Anti-Folate receptor alpha mAb - Research Grade

Product name PX-TA2207-50
Uniprot ID P15328
Source CAS: 2853518-94-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Folate receptor alpha, FOLR, FOLR1, Adult folate-binding protein, Folate receptor 1, FR-alpha, KB cells FBP, FBP, Ovarian tumor-associated antigen MOv18, Folate receptor, adult
Reference PX-TA2207-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Rinatabart Biosimilar - Anti-Folate receptor alpha mAb - Research Grade
Uniprot ID P15328
Source CAS: 2853518-94-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Folate receptor alpha, FOLR, FOLR1, Adult folate-binding protein, Folate receptor 1, FR-alpha, KB cells FBP, FBP, Ovarian tumor-associated antigen MOv18, Folate receptor, adult
Reference PX-TA2207-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Rinatabart Biosimilar - Anti-Folate receptor alpha mAb - Research Grade
Uniprot ID P15328
Source CAS: 2853518-94-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Folate receptor alpha, FOLR, FOLR1, Adult folate-binding protein, Folate receptor 1, FR-alpha, KB cells FBP, FBP, Ovarian tumor-associated antigen MOv18, Folate receptor, adult
Reference PX-TA2207-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Rinatabart Biosimilar is a therapeutic antibody that specifically targets the folate receptor alpha (FRα). This monoclonal antibody (mAb) is a research grade product that has been developed to mimic and improve upon the activity of its reference product, Tabortuzumab. In this article, we will discuss the structure, activity, and potential applications of Rinatabart Biosimilar in the field of cancer therapy.

Structure of Rinatabart Biosimilar

Rinatabart Biosimilar is a recombinant humanized IgG1 monoclonal antibody that has been engineered to have a high affinity for FRα. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region of Rinatabart Biosimilar is responsible for its specificity and binding to FRα, while the constant region is responsible for its effector functions.

The amino acid sequence of Rinatabart Biosimilar has been carefully designed to closely resemble that of Tabortuzumab, the reference product. This ensures that Rinatabart Biosimilar has a similar structure and activity as Tabortuzumab, making it a reliable and effective biosimilar.

Activity of Rinatabart Biosimilar

The main activity of Rinatabart Biosimilar is its ability to bind to FRα. FRα is a protein that is overexpressed in a variety of cancers, including ovarian, lung, and breast cancer. By targeting this protein, Rinatabart Biosimilar can selectively deliver its therapeutic payload to cancer cells, while sparing healthy cells.

Upon binding to FRα, Rinatabart Biosimilar can trigger a variety of anti-tumor effects. These include antibody-dependent cellular cytotoxicity (ADCC), complement-dependent cytotoxicity (CDC), and antibody-dependent phagocytosis (ADP). These mechanisms involve the activation of immune cells, such as natural killer cells and macrophages, to kill cancer cells.

In addition to its direct anti-tumor effects, Rinatabart Biosimilar can also inhibit the growth and proliferation of cancer cells by blocking the binding of folate to FRα. Folate is essential for cell growth and division, and by preventing its uptake, Rinatabart Biosimilar can slow down the growth of cancer cells.

Applications of Rinatabart Biosimilar

Rinatabart Biosimilar has the potential to be used in a variety of cancer therapies. Its ability to target FRα makes it a promising candidate for the treatment of ovarian, lung, and breast cancer. In addition, Rinatabart Biosimilar can also be used in combination with other cancer treatments, such as chemotherapy and radiation therapy, to enhance their effectiveness.

Furthermore, Rinatabart Biosimilar can also be used in diagnostic and research applications. Its high specificity for FRα makes it a valuable tool for detecting the presence and levels of this protein in cancer cells. This can aid in the diagnosis and monitoring of cancer progression.

Conclusion

Rinatabart Biosimilar is a promising therapeutic antibody that specifically targets FRα, a protein that is overexpressed in many types of cancer. Its carefully designed structure and activity make it a reliable and effective biosimilar to its reference product, Tabortuzumab. With its potential applications in cancer therapy, diagnostics, and research, Rinatabart Biosimilar has the potential to make a significant impact in the fight against cancer.

SDS-PAGE for Rinatabart Biosimilar - Research Grade

SDS-PAGE for Rinatabart Biosimilar - Research Grade

Rinatabart Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Rinatabart Biosimilar - Research Grade in ELISA Assay

Rinatabart Biosimilar - Research Grade in ELISA Assay

Rinatabart Biosimilar - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Rinatabart Biosimilar – Anti-Folate receptor alpha mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products