Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Bexatamig Biosimilar – Anti-CD123;CD335 mAb – Research Grade

  • PX-TA2177-50
  • Validated WB
Clonality:
Monoclonal Antibody
Isotype:
Ig (H-gamma1-VH-G1CH1h_L-kappa)_L-kappa G1hCH2CH3

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Bexatamig Biosimilar - Anti-CD123;CD335 mAb - Research Grade

Product name PX-TA2177-50
Uniprot ID P26951 & O76036
Source Bispecific, CAS: 2871775-98-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-IL-3R subunit alpha, IL-3 receptor subunit alpha, CD123, Interleukin-3 receptor subunit alpha, IL3R, IL-3R-alpha, IL3RA, IL-3RA, LY94, Natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NK-p46, CD335, NKp46, NCR1, hNKp46, Lymphocyte antigen 94 homolog
Reference PX-TA2177-100
Note For research use only. Not suitable for human use.
Isotype Ig (H-gamma1-VH-G1CH1h_L-kappa)_L-kappa G1hCH2CH3
Clonality Monoclonal Antibody
Product name Bexatamig Biosimilar - Anti-CD123;CD335 mAb - Research Grade
Uniprot ID P26951 & O76036
Source Bispecific, CAS: 2871775-98-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-IL-3R subunit alpha, IL-3 receptor subunit alpha, CD123, Interleukin-3 receptor subunit alpha, IL3R, IL-3R-alpha, IL3RA, IL-3RA, LY94, Natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NK-p46, CD335, NKp46, NCR1, hNKp46, Lymphocyte antigen 94 homolog
Reference PX-TA2177-100
Note For research use only. Not suitable for human use.
Isotype Ig (H-gamma1-VH-G1CH1h_L-kappa)_L-kappa G1hCH2CH3
Clonality Monoclonal Antibody
Product name Bexatamig Biosimilar - Anti-CD123;CD335 mAb - Research Grade
Uniprot ID P26951 & O76036
Source Bispecific, CAS: 2871775-98-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-IL-3R subunit alpha, IL-3 receptor subunit alpha, CD123, Interleukin-3 receptor subunit alpha, IL3R, IL-3R-alpha, IL3RA, IL-3RA, LY94, Natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NK-p46, CD335, NKp46, NCR1, hNKp46, Lymphocyte antigen 94 homolog
Reference PX-TA2177-100
Note For research use only. Not suitable for human use.
Isotype Ig (H-gamma1-VH-G1CH1h_L-kappa)_L-kappa G1hCH2CH3
Clonality Monoclonal Antibody

Introduction to Bexatamig Biosimilar – Anti-CD123;CD335 mAb

Bexatamig Biosimilar – Anti-CD123;CD335 mAb is a therapeutic antibody that has been developed as a biosimilar to the original Bexatamig antibody. This biosimilar has been specifically designed to target two important therapeutic targets, CD123 and CD335. In this article, we will explore the structure, activity, and potential applications of Bexatamig Biosimilar – Anti-CD123;CD335 mAb.

Structure of Bexatamig Biosimilar – Anti-CD123;CD335 mAb

Bexatamig Biosimilar – Anti-CD123;CD335 mAb is a monoclonal antibody, meaning it is produced by a single clone of cells. It is a humanized antibody, which means that it is derived from non-human sources but has been modified to be more similar to human antibodies. This modification reduces the risk of adverse reactions in patients.

The antibody has a Y-shaped structure, with two identical arms that can bind to the target molecules, CD123 and CD335. The constant region of the antibody is responsible for its effector functions, such as activating the immune system to attack cancer cells.

Activity of Bexatamig Biosimilar – Anti-CD123;CD335 mAb

The primary activity of Bexatamig Biosimilar – Anti-CD123;CD335 mAb is to bind to CD123 and CD335, which are both important therapeutic targets. CD123 is a cell surface receptor that is overexpressed on certain cancer cells, including acute myeloid leukemia (AML) and acute lymphoblastic leukemia (ALL). CD335 is a natural killer (NK) cell receptor that is involved in the immune response against cancer cells.

By binding to these targets, Bexatamig Biosimilar – Anti-CD123;CD335 mAb can inhibit the growth and survival of cancer cells. It can also activate the immune system, specifically NK cells, to directly kill cancer cells. This dual mechanism of action makes it a promising therapeutic antibody for the treatment of various cancers.

Applications of Bexatamig Biosimilar – Anti-CD123;CD335 mAb

Bexatamig Biosimilar – Anti-CD123;CD335 mAb has shown promising results in preclinical studies for the treatment of AML and ALL. It has also shown potential in targeting other cancers, such as multiple myeloma and solid tumors.

In addition to its potential as a cancer treatment, Bexatamig Biosimilar – Anti-CD123;CD335 mAb can also be used in research settings. Its ability to bind to CD123 and CD335 makes it a valuable tool for studying these therapeutic targets and their role in cancer development and progression.

Therapeutic Potential of Bexatamig Biosimilar – Anti-CD123;CD335 mAb

The development of Bexatamig Biosimilar – Anti-CD123;CD335 mAb as a biosimilar has the potential to provide patients with a more affordable and accessible treatment option. It also has the potential to improve treatment outcomes, as it has shown promising results in preclinical studies.

Furthermore, the dual targeting of CD123 and CD335 makes Bexatamig Biosimilar – Anti-CD123;CD335 mAb a unique and potentially more effective therapeutic antibody compared to other single-targeting antibodies.

Conclusion

In summary, Bexatamig Biosimilar – Anti-CD123;CD335 mAb is a promising therapeutic antibody that targets two important therapeutic targets, CD123 and CD335. Its unique structure and dual mechanism of action make it a potential treatment option for various cancers. Its development as a biosimilar also has the potential to improve treatment accessibility and affordability. Further research and clinical trials are needed to fully evaluate the therapeutic potential of Bexatamig Biosimilar – Anti-CD123;CD335

SDS-PAGE for Bexatamig Biosimilar - Research Grade

SDS-PAGE for Bexatamig Biosimilar - Research Grade

Bexatamig Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Bexatamig Biosimilar - Research Grade in WB Assay

Bexatamig Biosimilar - Research Grade in WB Assay

Bexatamig Biosimilar - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Bexatamig Biosimilar – Anti-CD123;CD335 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products