Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cugrastomig Biosimilar – Anti-LAG3;PD1 mAb – Research Grade

  • PX-TA2184-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
Ig IG fused to 2 scFv (H-gamma1-scFvhk_L'-kappa) dimer

Original price was: $221.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Cugrastomig Biosimilar - Anti-LAG3;PD1 mAb - Research Grade

Product name PX-TA2184-50
Uniprot ID P18627 & Q15116
Source Bispecific, Tetravalent, CAS: 2852680-10-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-FDC, LAG3, Lymphocyte activation gene 3 protein, CD223, sLAG-3, LAG-3, Programmed cell death protein 1, Protein PD-1, hPD-1, PD1, PDCD1, CD279
Reference PX-TA2184-100
Note For research use only. Not suitable for human use.
Isotype Ig IG fused to 2 scFv (H-gamma1-scFvhk_L'-kappa) dimer
Clonality Monoclonal Antibody
Product name Cugrastomig Biosimilar - Anti-LAG3;PD1 mAb - Research Grade
Uniprot ID P18627 & Q15116
Source Bispecific, Tetravalent, CAS: 2852680-10-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-FDC, LAG3, Lymphocyte activation gene 3 protein, CD223, sLAG-3, LAG-3, Programmed cell death protein 1, Protein PD-1, hPD-1, PD1, PDCD1, CD279
Reference PX-TA2184-100
Note For research use only. Not suitable for human use.
Isotype Ig IG fused to 2 scFv (H-gamma1-scFvhk_L'-kappa) dimer
Clonality Monoclonal Antibody
Product name Cugrastomig Biosimilar - Anti-LAG3;PD1 mAb - Research Grade
Uniprot ID P18627 & Q15116
Source Bispecific, Tetravalent, CAS: 2852680-10-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-FDC, LAG3, Lymphocyte activation gene 3 protein, CD223, sLAG-3, LAG-3, Programmed cell death protein 1, Protein PD-1, hPD-1, PD1, PDCD1, CD279
Reference PX-TA2184-100
Note For research use only. Not suitable for human use.
Isotype Ig IG fused to 2 scFv (H-gamma1-scFvhk_L'-kappa) dimer
Clonality Monoclonal Antibody

Introduction to Cugrastomig Biosimilar – Anti-LAG3;PD1 mAb

Cugrastomig Biosimilar – Anti-LAG3;PD1 mAb is a therapeutic antibody that targets two immune checkpoint proteins, LAG3 and PD1. This biosimilar is a research-grade version of the FDA-approved drug, Cugrastomig, which has shown promising results in treating various types of cancers. In this article, we will discuss the structure, activity, and potential applications of this therapeutic antibody.

Structure of Cugrastomig Biosimilar – Anti-LAG3;PD1 mAb

Cugrastomig Biosimilar – Anti-LAG3;PD1 mAb is a monoclonal antibody, meaning it is produced from a single clone of immune cells. It is a chimeric antibody, composed of both human and mouse components. The human portion of the antibody allows for better compatibility and reduced risk of adverse reactions in patients, while the mouse portion provides high specificity and affinity for its targets.

The antibody has a Y-shaped structure, with two identical heavy chains and two identical light chains. Each chain is made up of amino acids and contains a variable region that specifically binds to LAG3 and PD1 proteins. The constant region of the antibody determines its effector functions, such as activating the immune system to attack cancer cells.

Activity of Cugrastomig Biosimilar – Anti-LAG3;PD1 mAb

Cugrastomig Biosimilar – Anti-LAG3;PD1 mAb works by blocking the interaction between LAG3 and PD1 proteins and their respective ligands. LAG3 and PD1 are immune checkpoint proteins that are overexpressed on the surface of cancer cells, allowing them to evade the immune system. By blocking these interactions, the antibody enhances the anti-tumor immune response, leading to the destruction of cancer cells.

Moreover, this therapeutic antibody also has the ability to activate immune cells, such as T cells and natural killer cells, which play a crucial role in fighting cancer. It does so by binding to Fc receptors on these cells, triggering an immune response against cancer cells.

Therapeutic Target of Cugrastomig Biosimilar – Anti-LAG3;PD1 mAb

The therapeutic target of Cugrastomig Biosimilar – Anti-LAG3;PD1 mAb is LAG3 and PD1 proteins, which are immune checkpoint proteins found on the surface of cancer cells. These proteins play a critical role in suppressing the immune system and allowing cancer cells to evade detection and destruction. By targeting these proteins, the antibody helps to restore the immune system’s ability to recognize and eliminate cancer cells.

Applications of Cugrastomig Biosimilar – Anti-LAG3;PD1 mAb

Cugrastomig Biosimilar – Anti-LAG3;PD1 mAb has shown promising results in preclinical and clinical studies for the treatment of various types of cancers, including melanoma, lung cancer, and bladder cancer. It is currently being investigated in combination with other cancer treatments, such as chemotherapy and other immunotherapies, to enhance its efficacy.

Moreover, this therapeutic antibody can also be used in research studies to understand the role of LAG3 and PD1 proteins in cancer progression and to develop new treatments for cancer. Its high specificity and affinity make it a valuable tool for studying immune checkpoint proteins and their interactions with cancer cells.

Conclusion

In conclusion, Cugrastomig Biosimilar – Anti-LAG3;PD1 mAb is a promising therapeutic antibody that targets LAG3 and PD1 proteins, two immune checkpoint proteins that play a crucial role in cancer progression. Its unique structure, activity, and potential applications make it a valuable tool in the fight against cancer. Further research and clinical trials are needed to fully understand the potential of this biosimilar in treating various types of cancers.

SDS-PAGE for Cugrastomig Biosimilar - Research Grade

SDS-PAGE for Cugrastomig Biosimilar - Research Grade

Cugrastomig Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Cugrastomig Biosimilar - Research Grade in ELISA Assay

Cugrastomig Biosimilar - Research Grade in ELISA Assay

Cugrastomig Biosimilar - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Cugrastomig Biosimilar – Anti-LAG3;PD1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products