Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mipletamig Biosimilar – Anti-IL-3R subunit alpha;CD3e mAb – Research Grade

  • PX-TA2200-100
  • Validated WB
Clonality:
Monoclonal Antibody
Isotype:
Ig IG chain scFvkh-G1hCH2CH3-scFvhk dimer bisdisulfide

Original price was: $317.00.Current price is: $238.00.

100ug 25% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mipletamig Biosimilar - Anti-IL-3R subunit alpha;CD3e mAb - Research Grade

Product name PX-TA2200-50
Uniprot ID P26951 & P07766
Source Bispecific, Tetravalent, CAS: 2839556-21-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-IL-3R subunit alpha, IL-3 receptor subunit alpha, CD123, Interleukin-3 receptor subunit alpha, IL3R, IL-3R-alpha, IL3RA, IL-3RA, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA2200-100
Note For research use only. Not suitable for human use.
Isotype Ig IG chain scFvkh-G1hCH2CH3-scFvhk dimer bisdisulfide
Clonality Monoclonal Antibody
Product name Mipletamig Biosimilar - Anti-IL-3R subunit alpha;CD3e mAb - Research Grade
Uniprot ID P26951 & P07766
Source Bispecific, Tetravalent, CAS: 2839556-21-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-IL-3R subunit alpha, IL-3 receptor subunit alpha, CD123, Interleukin-3 receptor subunit alpha, IL3R, IL-3R-alpha, IL3RA, IL-3RA, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA2200-100
Note For research use only. Not suitable for human use.
Isotype Ig IG chain scFvkh-G1hCH2CH3-scFvhk dimer bisdisulfide
Clonality Monoclonal Antibody
Product name Mipletamig Biosimilar - Anti-IL-3R subunit alpha;CD3e mAb - Research Grade
Uniprot ID P26951 & P07766
Source Bispecific, Tetravalent, CAS: 2839556-21-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-IL-3R subunit alpha, IL-3 receptor subunit alpha, CD123, Interleukin-3 receptor subunit alpha, IL3R, IL-3R-alpha, IL3RA, IL-3RA, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA2200-100
Note For research use only. Not suitable for human use.
Isotype Ig IG chain scFvkh-G1hCH2CH3-scFvhk dimer bisdisulfide
Clonality Monoclonal Antibody

Introduction

Mipletamig Biosimilar – Anti-IL-3R subunit alpha;CD3e mAb – Research Grade is a therapeutic antibody that targets the IL-3 receptor subunit alpha and the CD3e protein. This biosimilar is designed to mimic the activity of the original therapeutic antibody, Mipletamig, which is used to treat various inflammatory conditions. In this article, we will discuss the structure, activity, and potential applications of Mipletamig Biosimilar in the field of medicine.

Structure of Mipletamig Biosimilar

Mipletamig Biosimilar is a monoclonal antibody, which means it is derived from a single clone of immune cells. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The heavy chains are responsible for the antibody’s binding activity, while the light chains help to stabilize the structure. The antibody has a Y-shaped structure, with two antigen-binding sites at the tips of the Y, allowing it to bind to its target with high specificity.

Activity of Mipletamig Biosimilar

Mipletamig Biosimilar is a targeted therapy that specifically binds to the IL-3 receptor subunit alpha and the CD3e protein. These proteins are found on the surface of immune cells, including T cells and mast cells, and play a crucial role in mediating inflammatory responses. By binding to these proteins, Mipletamig Biosimilar blocks their activity and reduces the production of inflammatory cytokines, ultimately leading to a decrease in inflammation.

Therapeutic Target of Mipletamig Biosimilar

The therapeutic target of Mipletamig Biosimilar is the IL-3 receptor subunit alpha and the CD3e protein. These proteins are involved in the activation and proliferation of immune cells, which can lead to excessive inflammation in various diseases. By targeting these proteins, Mipletamig Biosimilar can effectively modulate the immune response and provide relief from inflammatory conditions.

Applications of Mipletamig Biosimilar

Mipletamig Biosimilar has a wide range of potential applications in the field of medicine. It can be used to treat various inflammatory conditions, such as rheumatoid arthritis, psoriasis, and inflammatory bowel disease. It has also shown promising results in the treatment of allergic diseases, such as asthma and atopic dermatitis. Furthermore, Mipletamig Biosimilar has the potential to be used in combination with other therapies, such as chemotherapy, to enhance their effectiveness.

Research Grade Mipletamig Biosimilar

Mipletamig Biosimilar is available in a research grade, which is specifically designed for use in laboratory research. This grade of the biosimilar is highly pure and free from any contaminants, ensuring reliable and reproducible results in experiments. Researchers can use the research grade Mipletamig Biosimilar to study the mechanisms of inflammation and develop new therapeutic strategies for inflammatory diseases.

Conclusion

In summary, Mipletamig Biosimilar – Anti-IL-3R subunit alpha;CD3e mAb – Research Grade is a therapeutic antibody that targets the IL-3 receptor subunit alpha and the CD3e protein. It has a well-defined structure and a targeted mechanism of action, making it a promising therapy for various inflammatory conditions. With further research and development, Mipletamig Biosimilar has the potential to improve the lives of patients suffering from inflammatory diseases.

SDS-PAGE for Mipletamig Biosimilar - Research Grade

SDS-PAGE for Mipletamig Biosimilar - Research Grade

Mipletamig Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Mipletamig Biosimilar - Research Grade in WB Assay

Mipletamig Biosimilar - Research Grade in WB Assay

Mipletamig Biosimilar - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Mipletamig Biosimilar – Anti-IL-3R subunit alpha;CD3e mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products