Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Donzakimig Biosimilar – Anti-Interleukin-22; Albumin mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1(VH-CH1-h)-scFv_L-kappa-scFv

Original price was: $209.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Donzakimig Biosimilar - Anti-Interleukin-22; Albumin mAb - Research Grade

Product name PX-TA2114-50
Uniprot ID Q9GZX6 & P35225 & P02768
Source CAS: 2765066-99-5
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2114
Note For research use only. Not suitable for human use.
Isotype IgG1(VH-CH1-h)-scFv_L-kappa-scFv
Clonality Monoclonal Antibody
Product name Donzakimig Biosimilar - Anti-Interleukin-22; Albumin mAb - Research Grade
Uniprot ID Q9GZX6 & P35225 & P02768
Source CAS: 2765066-99-5
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2114
Note For research use only. Not suitable for human use.
Isotype IgG1(VH-CH1-h)-scFv_L-kappa-scFv
Clonality Monoclonal Antibody
Product name Donzakimig Biosimilar - Anti-Interleukin-22; Albumin mAb - Research Grade
Uniprot ID Q9GZX6 & P35225 & P02768
Source CAS: 2765066-99-5
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2114
Note For research use only. Not suitable for human use.
Isotype IgG1(VH-CH1-h)-scFv_L-kappa-scFv
Clonality Monoclonal Antibody

Introduction

Donzakimig Biosimilar – Anti-Interleukin-22, Albumin mAb – Research Grade is a novel therapeutic antibody that targets the cytokine Interleukin-22 (IL-22). This biosimilar is a monoclonal antibody (mAb) that specifically binds to IL-22, inhibiting its activity and providing potential therapeutic benefits for various diseases. In this article, we will discuss the structure, activity, and potential applications of Donzakimig Biosimilar – Anti-Interleukin-22, Albumin mAb – Research Grade.

Structure of Donzakimig Biosimilar – Anti-Interleukin-22, Albumin mAb – Research Grade Donzakimig Biosimilar – Anti-Interleukin-22, Albumin mAb – Research Grade is a recombinant humanized monoclonal antibody, meaning it is produced in the laboratory using recombinant DNA technology and has been engineered to have both human and mouse components. It is composed of two heavy chains and two light chains, each with a variable region that specifically binds to IL-22 and a constant region that determines the antibody’s effector functions.

The variable region of Donzakimig Biosimilar – Anti-Interleukin-22, Albumin mAb – Research Grade is derived from a mouse antibody, while the constant region is derived from a human antibody. This combination allows for high specificity and affinity towards IL-22, while also reducing the potential for immunogenicity in human patients.

Activity of Donzakimig Biosimilar – Anti-Interleukin-22, Albumin mAb – Research Grade IL-22 is a cytokine that plays a crucial role in inflammation, tissue repair, and immune response. However, excessive or dysregulated production of IL-22 has been linked to various diseases, including autoimmune disorders, inflammatory bowel disease, and cancer. Donzakimig Biosimilar – Anti-Interleukin-22, Albumin mAb – Research Grade works by binding to IL-22 and preventing it from interacting with its receptors, thereby inhibiting its activity.

This inhibition of IL-22 activity has been shown to reduce inflammation, promote tissue repair, and modulate immune responses in various preclinical studies. Additionally, Donzakimig Biosimilar – Anti-Interleukin-22, Albumin mAb – Research Grade has also been shown to have synergistic effects when used in combination with other therapies, such as chemotherapy, in the treatment of certain cancers.

Applications of Donzakimig Biosimilar – Anti-Interleukin-22, Albumin mAb – Research Grade Due to its ability to inhibit IL-22 activity, Donzakimig Biosimilar – Anti-Interleukin-22, Albumin mAb – Research Grade has potential applications in various diseases. Some of the potential therapeutic areas where this biosimilar could be beneficial include:

1. Autoimmune diseases: IL-22 has been implicated in the pathogenesis of autoimmune diseases, such as psoriasis, rheumatoid arthritis, and multiple sclerosis. By inhibiting IL-22 activity, Donzakimig Biosimilar – Anti-Interleukin-22, Albumin mAb – Research Grade could potentially provide therapeutic benefits in these conditions.

2. Inflammatory bowel disease (IBD): IBD, including Crohn’s disease and ulcerative colitis, is characterized by chronic inflammation in the gastrointestinal tract. IL-22 has been shown to play a role in the development of IBD, and Donzakimig Biosimilar – Anti-Interleukin-22, Albumin mAb – Research Grade could potentially be used to reduce inflammation and alleviate symptoms in these patients.

3.

Cancer: IL-22 has been shown to promote tumor growth and metastasis in various types of cancer. By inhibiting IL-22 activity, Donzakimig Biosimilar – Anti-Interleukin-22, Albumin mAb – Research Grade could potentially be used as an adjuvant therapy in the treatment of certain cancers, such as

SDS-PAGE for Research Grade Donzakimig

SDS-PAGE for Research Grade Donzakimig

Research Grade Donzakimig, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SDS-PAGE for Research Grade Donzakimig

SDS-PAGE for Research Grade Donzakimig

Research Grade Donzakimig, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Donzakimig Biosimilar - Anti-Interleukin-22; Albumin mAb - Research Grade

There are no reviews yet.

Be the first to review “Donzakimig Biosimilar – Anti-Interleukin-22; Albumin mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products