Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Amlenetug Biosimilar – Anti-Alpha-synuclein mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $226.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Amlenetug Biosimilar - Anti-Alpha-synuclein mAb - Research Grade

Product name PX-TA2166-50
Uniprot ID P37840
Source CAS: 2850367-41-6
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Alpha-synuclein, PARK1, Non-A4 component of amyloid precursor, NACP, Non-A beta component of AD amyloid, SNCA
Reference PX-TA2166-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Amlenetug Biosimilar - Anti-Alpha-synuclein mAb - Research Grade
Uniprot ID P37840
Source CAS: 2850367-41-6
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Alpha-synuclein, PARK1, Non-A4 component of amyloid precursor, NACP, Non-A beta component of AD amyloid, SNCA
Reference PX-TA2166-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Amlenetug Biosimilar - Anti-Alpha-synuclein mAb - Research Grade
Uniprot ID P37840
Source CAS: 2850367-41-6
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Alpha-synuclein, PARK1, Non-A4 component of amyloid precursor, NACP, Non-A beta component of AD amyloid, SNCA
Reference PX-TA2166-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Amlenetug Biosimilar is a therapeutic antibody that specifically targets the protein alpha-synuclein. This biosimilar is a research grade version of the original Amlenetug antibody, which has shown promising results in preclinical studies for the treatment of neurodegenerative diseases such as Parkinson’s and Alzheimer’s. In this article, we will discuss the structure, activity, and potential applications of Amlenetug Biosimilar as a promising therapeutic option for these debilitating diseases.

Structure of Amlenetug Biosimilar

Amlenetug Biosimilar is a monoclonal antibody, meaning it is produced from a single clone of cells and is therefore highly specific in its binding to its target protein. The antibody is composed of two identical heavy chains and two identical light chains, all of which are connected by disulfide bonds. The variable regions of the heavy and light chains are responsible for binding to alpha-synuclein, while the constant regions determine the antibody’s effector functions.

Targeting Alpha-synuclein

Alpha-synuclein is a protein that is found in high concentrations in the brain and is believed to play a role in the development of neurodegenerative diseases. In healthy individuals, alpha-synuclein is present in a soluble form, but in diseases such as Parkinson’s and Alzheimer’s, it can form clumps or aggregates that are toxic to neurons. Amlenetug Biosimilar specifically targets these aggregated forms of alpha-synuclein, preventing them from causing further damage to the brain.

Activity of Amlenetug Biosimilar

Amlenetug Biosimilar works by binding to alpha-synuclein and preventing its aggregation. This not only reduces the toxic effects of the protein, but also promotes its clearance from the brain. Additionally, the antibody can also activate the immune system to target and eliminate the aggregated forms of alpha-synuclein.

Preclinical Studies

In preclinical studies, Amlenetug Biosimilar has shown promising results in reducing the accumulation of alpha-synuclein and improving motor function in animal models of Parkinson’s and Alzheimer’s. It has also been shown to have a good safety profile, with no significant side effects observed.

Applications of Amlenetug Biosimilar

Given its ability to target and clear aggregated alpha-synuclein, Amlenetug Biosimilar has the potential to be an effective treatment option for neurodegenerative diseases. It could also be used as a diagnostic tool to detect the presence of aggregated alpha-synuclein in the brain, allowing for early detection and intervention in these diseases.

Therapeutic Potential

The development of Amlenetug Biosimilar as a therapeutic antibody has the potential to greatly impact the treatment of neurodegenerative diseases. It could potentially slow or even halt the progression of these diseases, improving the quality of life for patients and their caregivers.

Future Directions

Further research is needed to fully understand the potential of Amlenetug Biosimilar in the treatment of neurodegenerative diseases. Clinical trials are currently underway to evaluate its safety and efficacy in humans, and if successful, this biosimilar could become a valuable addition to the existing treatment options for these diseases.

Conclusion

In summary, Amlenetug Biosimilar is a promising therapeutic antibody that specifically targets and clears aggregated alpha-synuclein. Its structure, activity, and potential applications make it a promising candidate for the treatment of neurodegenerative diseases. Further research and clinical trials will determine its full potential and impact in the field of neurodegenerative disease treatment.

SDS-PAGE for Amlenetug Biosimilar - Research Grade

SDS-PAGE for Amlenetug Biosimilar - Research Grade

Amlenetug Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Amlenetug Biosimilar – Anti-Alpha-synuclein mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products