Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Precemtabart Biosimilar – Anti-Meconium antigen 100 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $224.00.Current price is: $167.00.

50ug 25% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Precemtabart Biosimilar - Anti-Meconium antigen 100 mAb - Research Grade

Product name PX-TA2212-50
Uniprot ID P06731
Source CAS: 2883118-92-9
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Meconium antigen 100, CEACAM5, CEA, CD66e, Carcinoembryonic antigen-related cell adhesion molecule 5, Carcinoembryonic antigen
Reference PX-TA2212-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Precemtabart Biosimilar - Anti-Meconium antigen 100 mAb - Research Grade
Uniprot ID P06731
Source CAS: 2883118-92-9
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Meconium antigen 100, CEACAM5, CEA, CD66e, Carcinoembryonic antigen-related cell adhesion molecule 5, Carcinoembryonic antigen
Reference PX-TA2212-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Precemtabart Biosimilar - Anti-Meconium antigen 100 mAb - Research Grade
Uniprot ID P06731
Source CAS: 2883118-92-9
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Meconium antigen 100, CEACAM5, CEA, CD66e, Carcinoembryonic antigen-related cell adhesion molecule 5, Carcinoembryonic antigen
Reference PX-TA2212-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Precemtabart Biosimilar – Anti-Meconium antigen 100 mAb – Research Grade is a therapeutic antibody that has been developed as a biosimilar to the original Precemtabart antibody. This biosimilar is specifically designed to target the Meconium antigen 100 (MA100), which is a protein found on the surface of certain cancer cells. In this article, we will discuss the structure, activity, and potential applications of this biosimilar.

Structure of Precemtabart Biosimilar – Anti-Meconium antigen 100 mAb

Precemtabart Biosimilar – Anti-Meconium antigen 100 mAb is a monoclonal antibody (mAb), meaning it is made up of identical immune cells that have been cloned from a single parent cell. This type of antibody is designed to specifically target a particular antigen, in this case, the Meconium antigen 100. The structure of this biosimilar is very similar to the original Precemtabart antibody, with minor modifications to ensure its effectiveness and safety.

The mAb is made up of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains contain the antigen-binding region, while the light chains are responsible for binding to immune cells and activating the immune response. The structure of this biosimilar is critical to its activity and effectiveness in targeting the Meconium antigen 100.

Activity of Precemtabart Biosimilar – Anti-Meconium antigen 100 mAb

Precemtabart Biosimilar – Anti-Meconium antigen 100 mAb works by specifically binding to the Meconium antigen 100 on the surface of cancer cells. This binding triggers a series of events that lead to the destruction of the cancer cells. The mAb can also activate the immune system to recognize and attack the cancer cells, providing a dual mechanism of action.

The activity of this biosimilar is highly specific, meaning it only targets cells that express the Meconium antigen 100. This helps to minimize any potential side effects and ensures that healthy cells are not affected. Additionally, the biosimilar is designed to have a longer half-life, meaning it can remain active in the body for a longer period, providing sustained therapeutic effects.

Therapeutic Target: Meconium antigen 100

The Meconium antigen 100 is a protein that is overexpressed on the surface of certain cancer cells, making it an ideal therapeutic target. This antigen is not found on healthy cells, making it a specific and effective target for cancer treatment. By targeting this antigen, Precemtabart Biosimilar – Anti-Meconium antigen 100 mAb can specifically attack cancer cells while sparing healthy cells, reducing the risk of side effects.

Applications of Precemtabart Biosimilar – Anti-Meconium antigen 100 mAb

Precemtabart Biosimilar – Anti-Meconium antigen 100 mAb has potential applications in the treatment of various cancers, including breast cancer, lung cancer, and ovarian cancer. It can be used as a standalone therapy or in combination with other cancer treatments, such as chemotherapy or radiation therapy.

This biosimilar is currently in the research grade stage, meaning it is being studied in clinical trials to determine its safety and effectiveness. If successful, it has the potential to provide a more affordable and accessible treatment option for cancer patients, as biosimilars are typically less expensive than the original biologic drugs.

Conclusion

In conclusion, Precemtabart Biosimilar – Anti-Meconium antigen 100 mAb – Research Grade is a promising therapeutic antibody that specifically targets the Meconium antigen 100 on cancer cells. Its structure and activity make it an effective and safe treatment option for various cancers, and it has the potential to provide a more affordable and accessible treatment option for patients. Further research and clinical trials are needed to fully understand the potential of this biosimilar, but it holds great promise for the future of cancer treatment.

SDS-PAGE for Precemtabart Biosimilar - Research Grade

SDS-PAGE for Precemtabart Biosimilar - Research Grade

Precemtabart Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Precemtabart Biosimilar – Anti-Meconium antigen 100 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products