Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mannose-binding protein A

Host species:
Insect
Uniprot ID:
P39039
Molecular weight:
26.50kDa

Original price was: $351.00.Current price is: $308.00.

50ug 12% OFF + 308 loyalty points
Ser19–Ala239 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mannose-binding protein A

Product name Mannose-binding protein A
Uniprot ID P39039
Uniprot link https://www.uniprot.org/uniprot/P39039
Expression system Eukaryotic expression
Raw Antigen Sequence SGSQTCEDTLKTCSVIACGRDGRDGPKGEKGEPGQGLRGLQGPPGKLGPPGSVGSPGSPGPKGQKGDHGDNRAIEEKLANMEAEIRILKSKLQLTNKLHAFSMGKKSGKKLFVTNHEKMPFSKVKSLCTELQGTVAIPRNAEENKAIQEVATGIAFLGITDEATEGQFMYVTGGRLTYSNWKKDEPNNHGSGEDCVIILDNGLWNDISCQASFKAVCEFPA
Molecular weight 26.50kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Ser19-Ala239
Protein Accession P39039
Spec:Entrez GeneID 17194
Spec:NCBI Gene Aliases MBL; MBP; MBL-A; MBP-A; S-MBP
Spec:SwissProtID Q0P6H1
NCBI Reference P39039
Aliases /Synonyms Mbl1
Reference PX-P4451
Note For research use only
Molecular Constructor
Ser19–Ala239 His
Product name Mannose-binding protein A
Uniprot ID P39039
Uniprot link https://www.uniprot.org/uniprot/P39039
Expression system Eukaryotic expression
Raw Antigen Sequence SGSQTCEDTLKTCSVIACGRDGRDGPKGEKGEPGQGLRGLQGPPGKLGPPGSVGSPGSPGPKGQKGDHGDNRAIEEKLANMEAEIRILKSKLQLTNKLHAFSMGKKSGKKLFVTNHEKMPFSKVKSLCTELQGTVAIPRNAEENKAIQEVATGIAFLGITDEATEGQFMYVTGGRLTYSNWKKDEPNNHGSGEDCVIILDNGLWNDISCQASFKAVCEFPA
Molecular weight 26.50kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Ser19-Ala239
Protein Accession P39039
Spec:Entrez GeneID 17194
Spec:NCBI Gene Aliases MBL; MBP; MBL-A; MBP-A; S-MBP
Spec:SwissProtID Q0P6H1
NCBI Reference P39039
Aliases /Synonyms Mbl1
Reference PX-P4451
Note For research use only
Molecular Constructor
Ser19–Ala239 His
Product name PX-P4451-1MG
Uniprot ID P39039
Uniprot link https://www.uniprot.org/uniprot/P39039
Expression system Eukaryotic expression
Raw Antigen Sequence SGSQTCEDTLKTCSVIACGRDGRDGPKGEKGEPGQGLRGLQGPPGKLGPPGSVGSPGSPGPKGQKGDHGDNRAIEEKLANMEAEIRILKSKLQLTNKLHAFSMGKKSGKKLFVTNHEKMPFSKVKSLCTELQGTVAIPRNAEENKAIQEVATGIAFLGITDEATEGQFMYVTGGRLTYSNWKKDEPNNHGSGEDCVIILDNGLWNDISCQASFKAVCEFPA
Molecular weight 26.50kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Ser19-Ala239
Protein Accession P39039
Spec:Entrez GeneID 17194
Spec:NCBI Gene Aliases MBL; MBP; MBL-A; MBP-A; S-MBP
Spec:SwissProtID Q0P6H1
NCBI Reference P39039
Aliases /Synonyms Mbl1
Reference PX-P4451
Note For research use only
Molecular Constructor
Ser19–Ala239 His

Mannose-binding protein A

There are no reviews yet.

Be the first to review “Mannose-binding protein A”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products