Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Alpha-amylase – trypsin inhibitor CM3

  • PX-P4286-10
Host species:
Insect
Uniprot ID:
P17314
Molecular weight:
18.74kDa

$250.00

+ 250 loyalty points
Ser26–IIe168
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Alpha-amylase - trypsin inhibitor CM3

Alpha-amylase - trypsin inhibitor CM3

Product name Alpha-amylase - trypsin inhibitor CM3
Uniprot ID P17314
Uniprot link https://www.uniprot.org/uniprot/P17314
Expression system Eukaryotic expression
Sequence MKMIILVVSLHVLRNSAASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVGESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWIGSHHHHHH
Molecular weight 18.74kDa
Purity estimated >50% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Ser26-IIe168
Aliases /Synonyms Chloroform/methanol-soluble protein CM3
Reference PX-P4286
Note For research use only
Molecular Constructor
Ser26–IIe168
Product name Alpha-amylase - trypsin inhibitor CM3
Uniprot ID P17314
Uniprot link https://www.uniprot.org/uniprot/P17314
Expression system Eukaryotic expression
Sequence MKMIILVVSLHVLRNSAASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVGESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWIGSHHHHHH
Molecular weight 18.74kDa
Purity estimated >50% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Ser26-IIe168
Aliases /Synonyms Chloroform/methanol-soluble protein CM3
Reference PX-P4286
Note For research use only
Molecular Constructor
Ser26–IIe168

There are no reviews yet.

Be the first to review “Alpha-amylase – trypsin inhibitor CM3”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products