Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

MOGAT1, N-His, recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q96PD6
Molecular weight:
22.97 kDa

$392.00

100ug + 392 loyalty points
His Arg153–Lys335
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
MOGAT1, N-His, recombinant protein

MOGAT1, N-His, recombinant protein

Product name MOGAT1, N-His, recombinant protein
Uniprot ID Q96PD6
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence REYVMSVGLVSVSKKSVSYMVSKEGGGNISVIVLGGAKESLDAHPGKFTLFIRQRKGFVKIALTHGASLVPVVSFGENELFKQTDNPEGSWIRTVQNKLQKIMGFALPLFHARGVFQYNFGLMTYRKAIHTVVGRPIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK
Molecular weight 22.97 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg153-Lys335
Protein Accession Q96PD6
Reference PX-P5834
Note For research use only
Molecular Constructor
His Arg153–Lys335

MOGAT1, N-His, recombinant protein

There are no reviews yet.

Be the first to review “MOGAT1, N-His, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products