Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Mouse AGR3 Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
Q8R3W7
Molecular weight:
19.92 kDa

Original price was: $476.00.Current price is: $387.00.

100ug 19% OFF + 387 loyalty points
Ile21–Leu165 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Mouse AGR3 Recombinant Protein, C-His

Mouse AGR3 Recombinant Protein, C-His

Product name ARO-P20426-100
Uniprot ID Q8R3W7
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence IAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFHARKSNKPLMVIHHLEDCQYCQALKKEFAKNEEIQEMAQNDFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYTYEPQDLPMLVDNMKKALRLIQSEL
Molecular weight 19.92 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ile21-Leu165
Aliases /Synonyms AG-3, AG3, AGR3, Anterior gradient 3 homolog, Anterior gradient protein 3, BCMP11, Breast cancer membrane protein 11, PDIA18, Protein disulfide isomerase family A, member 18, hAG-3
Reference ARO-P20426
Note For research use only.
Molecular Constructor
Ile21–Leu165 His
Product name ARO-P20426-1MG
Uniprot ID Q8R3W7
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence IAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFHARKSNKPLMVIHHLEDCQYCQALKKEFAKNEEIQEMAQNDFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYTYEPQDLPMLVDNMKKALRLIQSEL
Molecular weight 19.92 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ile21-Leu165
Aliases /Synonyms AG-3, AG3, AGR3, Anterior gradient 3 homolog, Anterior gradient protein 3, BCMP11, Breast cancer membrane protein 11, PDIA18, Protein disulfide isomerase family A, member 18, hAG-3
Reference ARO-P20426
Note For research use only.
Molecular Constructor
Ile21–Leu165 His
Product name ARO-P20426-50
Uniprot ID Q8R3W7
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence IAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFHARKSNKPLMVIHHLEDCQYCQALKKEFAKNEEIQEMAQNDFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYTYEPQDLPMLVDNMKKALRLIQSEL
Molecular weight 19.92 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ile21-Leu165
Aliases /Synonyms AG-3, AG3, AGR3, Anterior gradient 3 homolog, Anterior gradient protein 3, BCMP11, Breast cancer membrane protein 11, PDIA18, Protein disulfide isomerase family A, member 18, hAG-3
Reference ARO-P20426
Note For research use only.
Molecular Constructor
Ile21–Leu165 His

There are no reviews yet.

Be the first to review “Mouse AGR3 Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products