Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Mouse CD256/TNFSF13 Recombinant Protein, N-Fc

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
Q9D777

Original price was: $303.00.Current price is: $271.00.

50ug 11% OFF + 271 loyalty points
Fc Lys104–Leu241
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Mouse CD256/TNFSF13 Recombinant Protein, N-Fc

Mouse CD256/TNFSF13 Recombinant Protein, N-Fc

Product name ARO-P18315-100
Uniprot ID Q9D777
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence KKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
Protein delivered with Tag? N-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Lys104-Leu241
Aliases /Synonyms Tumor necrosis factor ligand superfamily member 13, A proliferation-inducing ligand, APRIL, CD256, Tnfsf13, April
Reference ARO-P18315
Note For research use only.
Molecular Constructor
Fc Lys104–Leu241
Product name ARO-P18315-1MG
Uniprot ID Q9D777
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence KKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
Protein delivered with Tag? N-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Lys104-Leu241
Aliases /Synonyms Tumor necrosis factor ligand superfamily member 13, A proliferation-inducing ligand, APRIL, CD256, Tnfsf13, April
Reference ARO-P18315
Note For research use only.
Molecular Constructor
Fc Lys104–Leu241
Product name ARO-P18315-50
Uniprot ID Q9D777
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence KKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
Protein delivered with Tag? N-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Lys104-Leu241
Aliases /Synonyms Tumor necrosis factor ligand superfamily member 13, A proliferation-inducing ligand, APRIL, CD256, Tnfsf13, April
Reference ARO-P18315
Note For research use only.
Molecular Constructor
Fc Lys104–Leu241

There are no reviews yet.

Be the first to review “Mouse CD256/TNFSF13 Recombinant Protein, N-Fc”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products