Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Mouse ARTN recombinant protein

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
Q9Z0L2
Molecular weight:
39.94 kDa

Original price was: $375.00.Current price is: $315.00.

50ug 16% OFF + 315 loyalty points
Fc Ala112–Gly224
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Mouse ARTN recombinant protein

Mouse ARTN recombinant protein

Product name PX-P6387-100
Uniprot ID Q9Z0L2
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence AGTRSSRARTTDARGCRLRSQLVPVSALGLGHSSDELIRFRFCSGSCRRARSQHDLSLASLLGAGALRSPPGSRPISQPCCRPTRYEAVSFMDVNSTWRTVDHLSATACGCLG
Molecular weight 39.94 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala112-Gly224
Aliases /Synonyms ArtnArtemin,
Reference PX-P6387
Molecular Constructor
Fc Ala112–Gly224
Product name PX-P6387-1MG
Uniprot ID Q9Z0L2
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence AGTRSSRARTTDARGCRLRSQLVPVSALGLGHSSDELIRFRFCSGSCRRARSQHDLSLASLLGAGALRSPPGSRPISQPCCRPTRYEAVSFMDVNSTWRTVDHLSATACGCLG
Molecular weight 39.94 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala112-Gly224
Aliases /Synonyms ArtnArtemin,
Reference PX-P6387
Molecular Constructor
Fc Ala112–Gly224
Product name PX-P6387-50
Uniprot ID Q9Z0L2
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence AGTRSSRARTTDARGCRLRSQLVPVSALGLGHSSDELIRFRFCSGSCRRARSQHDLSLASLLGAGALRSPPGSRPISQPCCRPTRYEAVSFMDVNSTWRTVDHLSATACGCLG
Molecular weight 39.94 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala112-Gly224
Aliases /Synonyms ArtnArtemin,
Reference PX-P6387
Molecular Constructor
Fc Ala112–Gly224

Mouse ARTN recombinant protein

There are no reviews yet.

Be the first to review “Mouse ARTN recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products