Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse TREM2 recombinant protein

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
Q99NH8
Molecular weight:
19.42 kDa

Original price was: $440.00.Current price is: $380.00.

100ug 14% OFF + 380 loyalty points
Ala18–Pro168 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Mouse TREM2 recombinant protein

Mouse TREM2 recombinant protein

Product name PX-P6409-100
Uniprot ID Q99NH8
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence ALNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFP
Molecular weight 19.42 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala18-Pro168
Aliases /Synonyms TREM-2, Triggering receptor expressed on monocytes 2, Trem2, Trem2a, Trem2b, Trem2cTriggering receptor expressed on myeloid cells 2,
Reference PX-P6409
Molecular Constructor
Ala18–Pro168 His
Product name PX-P6409-1MG
Uniprot ID Q99NH8
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence ALNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFP
Molecular weight 19.42 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala18-Pro168
Aliases /Synonyms TREM-2, Triggering receptor expressed on monocytes 2, Trem2, Trem2a, Trem2b, Trem2cTriggering receptor expressed on myeloid cells 2,
Reference PX-P6409
Molecular Constructor
Ala18–Pro168 His
Product name PX-P6409-50
Uniprot ID Q99NH8
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence ALNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFP
Molecular weight 19.42 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala18-Pro168
Aliases /Synonyms TREM-2, Triggering receptor expressed on monocytes 2, Trem2, Trem2a, Trem2b, Trem2cTriggering receptor expressed on myeloid cells 2,
Reference PX-P6409
Molecular Constructor
Ala18–Pro168 His

Mouse TREM2 recombinant protein

There are no reviews yet.

Be the first to review “Mouse TREM2 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products