Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse CD154 recombinant protein

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
P27548
Molecular weight:
22.58 kDa

Original price was: $402.00.Current price is: $330.00.

50ug 18% OFF + 330 loyalty points
His Met112–Leu260
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Mouse CD154 recombinant protein

Mouse CD154 recombinant protein

Product name PX-P6406-100
Uniprot ID P27548
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
Molecular weight 22.58 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met112-Leu260
Aliases /Synonyms CD40-L, T-cell antigen Gp39, TNF-related activation protein, TRAP, Tumor necrosis factor ligand superfamily member 5, CD154, CD40 ligand, membrane form, CD40 ligand, soluble form, sCD40L, Cd40lg, Cd40l, Tnfsf5CD40 ligand,
Reference PX-P6406
Molecular Constructor
His Met112–Leu260
Product name PX-P6406-1MG
Uniprot ID P27548
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
Molecular weight 22.58 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met112-Leu260
Aliases /Synonyms CD40-L, T-cell antigen Gp39, TNF-related activation protein, TRAP, Tumor necrosis factor ligand superfamily member 5, CD154, CD40 ligand, membrane form, CD40 ligand, soluble form, sCD40L, Cd40lg, Cd40l, Tnfsf5CD40 ligand,
Reference PX-P6406
Molecular Constructor
His Met112–Leu260
Product name PX-P6406-50
Uniprot ID P27548
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
Molecular weight 22.58 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met112-Leu260
Aliases /Synonyms CD40-L, T-cell antigen Gp39, TNF-related activation protein, TRAP, Tumor necrosis factor ligand superfamily member 5, CD154, CD40 ligand, membrane form, CD40 ligand, soluble form, sCD40L, Cd40lg, Cd40l, Tnfsf5CD40 ligand,
Reference PX-P6406
Molecular Constructor
His Met112–Leu260

Mouse CD154 recombinant protein

There are no reviews yet.

Be the first to review “Mouse CD154 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products