Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Mouse CXCL17/DMC/VCC1 Recombinant Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q5UW37
Molecular weight:
38.04 kDa

Original price was: $314.00.Current price is: $271.00.

50ug 14% OFF + 271 loyalty points
GST His36–Leu119 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Mouse CXCL17/DMC/VCC1 Recombinant Protein, N-GST & C-His

Mouse CXCL17/DMC/VCC1 Recombinant Protein, N-GST & C-His

Product name ARO-P20719-100
Uniprot ID Q5UW37
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HLAPRRWLLEGGQECECKDWFLQAPKRKATAVLGPPRKQCPCDHVKGREKKNRHQKHHRKSQRPSRACQQFLKRCHLASFALPL
Molecular weight 38.04 kDa
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His36-Leu119
Aliases /Synonyms 4-Cys CXCL17, 6-Cys CXCL17, C-X-C motif chemokine 17, CXCL17, DMC, Dendritic cell and monocyte chemokine-like protein, VCC1, VEGF coregulated chemokine 1
Reference ARO-P20719
Note For research use only.
Molecular Constructor
GST His36–Leu119 His
Product name ARO-P20719-1MG
Uniprot ID Q5UW37
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HLAPRRWLLEGGQECECKDWFLQAPKRKATAVLGPPRKQCPCDHVKGREKKNRHQKHHRKSQRPSRACQQFLKRCHLASFALPL
Molecular weight 38.04 kDa
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His36-Leu119
Aliases /Synonyms 4-Cys CXCL17, 6-Cys CXCL17, C-X-C motif chemokine 17, CXCL17, DMC, Dendritic cell and monocyte chemokine-like protein, VCC1, VEGF coregulated chemokine 1
Reference ARO-P20719
Note For research use only.
Molecular Constructor
GST His36–Leu119 His
Product name ARO-P20719-50
Uniprot ID Q5UW37
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HLAPRRWLLEGGQECECKDWFLQAPKRKATAVLGPPRKQCPCDHVKGREKKNRHQKHHRKSQRPSRACQQFLKRCHLASFALPL
Molecular weight 38.04 kDa
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His36-Leu119
Aliases /Synonyms 4-Cys CXCL17, 6-Cys CXCL17, C-X-C motif chemokine 17, CXCL17, DMC, Dendritic cell and monocyte chemokine-like protein, VCC1, VEGF coregulated chemokine 1
Reference ARO-P20719
Note For research use only.
Molecular Constructor
GST His36–Leu119 His

There are no reviews yet.

Be the first to review “Mouse CXCL17/DMC/VCC1 Recombinant Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products