Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse HSD17B4 Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P51660
Molecular weight:
32.21 kDa

Original price was: $347.00.Current price is: $271.00.

50ug 22% OFF + 271 loyalty points
His Ser333–Pro606
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse HSD17B4 Recombinant Protein, N-His

Product name ARO-P20254-100
Uniprot ID P51660
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SFSSSYTELQSIMYALGVGASVKNPKDLKFVYEGSADFSCLPTFGVIVAQKSMMNGGLAEVPGLSFNFAKALHGEQYLELYKPLPRSGELKCEAVIADILDKGSGVVIVMDVYSYSGKELICYNQFSVFVVGSGGFGGKRTSEKLKAAVAVPNRPPDAVLRDATSLNQAALYRLSGDWNPLHIDPDFASVAGFEKPILHGLCTFGFSARHVLQQFADNDVSRFKAIKVRFAKPVYPGQTLQTEMWKEGNRIHFQTKVHETGDVVISNAYVDLVP
Molecular weight 32.21 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser333-Pro606
Aliases /Synonyms (3R)-hydroxyacyl-CoA dehydrogenase, 17-beta-HSD 4, 17-beta-hydroxysteroid dehydrogenase 4, 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase, D-bifunctional protein, DBP, EC:1.1.1.n12, EC:4.2.1.107, EC:4.2.1.119, EDH17B4, Enoyl-CoA hydratase 2, HSD17B4, MFE-2, MFP-2, Multifunctional protein 2, Peroxisomal multifunctional enzyme type 2, SDR8C1, Short chain dehydrogenase/reductase family 8C member 1
Reference ARO-P20254
Note For research use only.
Molecular Constructor
His Ser333–Pro606
Product name ARO-P20254-1MG
Uniprot ID P51660
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SFSSSYTELQSIMYALGVGASVKNPKDLKFVYEGSADFSCLPTFGVIVAQKSMMNGGLAEVPGLSFNFAKALHGEQYLELYKPLPRSGELKCEAVIADILDKGSGVVIVMDVYSYSGKELICYNQFSVFVVGSGGFGGKRTSEKLKAAVAVPNRPPDAVLRDATSLNQAALYRLSGDWNPLHIDPDFASVAGFEKPILHGLCTFGFSARHVLQQFADNDVSRFKAIKVRFAKPVYPGQTLQTEMWKEGNRIHFQTKVHETGDVVISNAYVDLVP
Molecular weight 32.21 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser333-Pro606
Aliases /Synonyms (3R)-hydroxyacyl-CoA dehydrogenase, 17-beta-HSD 4, 17-beta-hydroxysteroid dehydrogenase 4, 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase, D-bifunctional protein, DBP, EC:1.1.1.n12, EC:4.2.1.107, EC:4.2.1.119, EDH17B4, Enoyl-CoA hydratase 2, HSD17B4, MFE-2, MFP-2, Multifunctional protein 2, Peroxisomal multifunctional enzyme type 2, SDR8C1, Short chain dehydrogenase/reductase family 8C member 1
Reference ARO-P20254
Note For research use only.
Molecular Constructor
His Ser333–Pro606
Product name ARO-P20254-50
Uniprot ID P51660
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SFSSSYTELQSIMYALGVGASVKNPKDLKFVYEGSADFSCLPTFGVIVAQKSMMNGGLAEVPGLSFNFAKALHGEQYLELYKPLPRSGELKCEAVIADILDKGSGVVIVMDVYSYSGKELICYNQFSVFVVGSGGFGGKRTSEKLKAAVAVPNRPPDAVLRDATSLNQAALYRLSGDWNPLHIDPDFASVAGFEKPILHGLCTFGFSARHVLQQFADNDVSRFKAIKVRFAKPVYPGQTLQTEMWKEGNRIHFQTKVHETGDVVISNAYVDLVP
Molecular weight 32.21 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser333-Pro606
Aliases /Synonyms (3R)-hydroxyacyl-CoA dehydrogenase, 17-beta-HSD 4, 17-beta-hydroxysteroid dehydrogenase 4, 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase, D-bifunctional protein, DBP, EC:1.1.1.n12, EC:4.2.1.107, EC:4.2.1.119, EDH17B4, Enoyl-CoA hydratase 2, HSD17B4, MFE-2, MFP-2, Multifunctional protein 2, Peroxisomal multifunctional enzyme type 2, SDR8C1, Short chain dehydrogenase/reductase family 8C member 1
Reference ARO-P20254
Note For research use only.
Molecular Constructor
His Ser333–Pro606

There are no reviews yet.

Be the first to review “Mouse HSD17B4 Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products