Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CCL3/MIP-1-alpha Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P10855
Molecular weight:
20.23 kDa

Original price was: $326.00.Current price is: $274.00.

50ug 16% OFF + 274 loyalty points
Ser23–Ala92
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CCL3/MIP-1-alpha Protein, N-His-SUMO

Product name ARO-P11131-100
Uniprot ID P10855
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SAPYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
Molecular weight 20.23 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser23-Ala92
Aliases /Synonyms Tonsillar lymphocyte LD78 alpha protein, CCL3, G0S19-1, MIP1A, Macrophage inflammatory protein 1-alpha, LD78-alpha(4-69), SCYA3, SIS-beta, Small-inducible cytokine A3, C-C motif chemokine 3, G0/G1 switch regulatory protein 19-1, PAT 464.1, MIP-1-alpha
Reference ARO-P11131
Note For research use only.
Molecular Constructor
Ser23–Ala92
Product name ARO-P11131-1MG
Uniprot ID P10855
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SAPYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
Molecular weight 20.23 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser23-Ala92
Aliases /Synonyms Tonsillar lymphocyte LD78 alpha protein, CCL3, G0S19-1, MIP1A, Macrophage inflammatory protein 1-alpha, LD78-alpha(4-69), SCYA3, SIS-beta, Small-inducible cytokine A3, C-C motif chemokine 3, G0/G1 switch regulatory protein 19-1, PAT 464.1, MIP-1-alpha
Reference ARO-P11131
Note For research use only.
Molecular Constructor
Ser23–Ala92
Product name ARO-P11131-50
Uniprot ID P10855
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SAPYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
Molecular weight 20.23 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser23-Ala92
Aliases /Synonyms Tonsillar lymphocyte LD78 alpha protein, CCL3, G0S19-1, MIP1A, Macrophage inflammatory protein 1-alpha, LD78-alpha(4-69), SCYA3, SIS-beta, Small-inducible cytokine A3, C-C motif chemokine 3, G0/G1 switch regulatory protein 19-1, PAT 464.1, MIP-1-alpha
Reference ARO-P11131
Note For research use only.
Molecular Constructor
Ser23–Ala92

Recombinant Mouse CCL3/MIP-1-alpha Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse CCL3/MIP-1-alpha Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products