Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse SELENOP Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P70274
Molecular weight:
19.10 kDa

Original price was: $315.00.Current price is: $274.00.

50ug 13% OFF + 274 loyalty points
Ser25–Arg171
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse SELENOP Protein, N-His

Product name ARO-P10570-100
Uniprot ID P70274
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SSACYKAPEWYIGDQNPMLNSEGKVTVVALLQASUYLCLLQASRLEDLRIKLESQGYFNISYIVVNHQGSPSQLKHSHLKKQVSEHIAVYRQEEDGIDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFPYVEEAIKIAYCEER
Molecular weight 19.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser25-Arg171
Aliases /Synonyms SEPP1, SeP, Selenoprotein P, SELP, SELENOP
Reference ARO-P10570
Note For research use only.
Molecular Constructor
Ser25–Arg171
Product name ARO-P10570-1MG
Uniprot ID P70274
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SSACYKAPEWYIGDQNPMLNSEGKVTVVALLQASUYLCLLQASRLEDLRIKLESQGYFNISYIVVNHQGSPSQLKHSHLKKQVSEHIAVYRQEEDGIDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFPYVEEAIKIAYCEER
Molecular weight 19.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser25-Arg171
Aliases /Synonyms SEPP1, SeP, Selenoprotein P, SELP, SELENOP
Reference ARO-P10570
Note For research use only.
Molecular Constructor
Ser25–Arg171
Product name ARO-P10570-50
Uniprot ID P70274
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SSACYKAPEWYIGDQNPMLNSEGKVTVVALLQASUYLCLLQASRLEDLRIKLESQGYFNISYIVVNHQGSPSQLKHSHLKKQVSEHIAVYRQEEDGIDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFPYVEEAIKIAYCEER
Molecular weight 19.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser25-Arg171
Aliases /Synonyms SEPP1, SeP, Selenoprotein P, SELP, SELENOP
Reference ARO-P10570
Note For research use only.
Molecular Constructor
Ser25–Arg171

Introduction to Recombinant Mouse SELENOP Protein

Recombinant Mouse SELENOP Protein, also known as Selenium Binding Protein 1, is a protein that plays a crucial role in the body’s antioxidant defense system. It is a 56-kDa glycoprotein that is primarily expressed in the liver and secreted into the bloodstream. This protein is essential for the transport and regulation of the trace element selenium, which is required for the proper functioning of various enzymes in the body.

Structure of Recombinant Mouse SELENOP Protein

The structure of Recombinant Mouse SELENOP Protein consists of a single polypeptide chain with 486 amino acids. It has a signal peptide at the N-terminus, which is responsible for its secretion into the bloodstream. The protein also contains a highly conserved selenium-binding domain, which is essential for its function. The protein is heavily glycosylated, with approximately 40% of its mass consisting of carbohydrates.

Recombinant Mouse SELENOP Protein is a member of the selenoprotein family, which contains 25 known members in humans and 24 in mice. This protein shares a high degree of sequence homology with other selenoproteins, indicating a similar function and evolutionary origin.

Activity of Recombinant Mouse SELENOP Protein

The primary function of Recombinant Mouse SELENOP Protein is to transport and regulate the levels of selenium in the body. Selenium is an essential trace element that is required for the proper functioning of various enzymes, including glutathione peroxidase, thioredoxin reductase, and iodothyronine deiodinases. These enzymes play a crucial role in antioxidant defense, thyroid hormone metabolism, and redox homeostasis.

Recombinant Mouse SELENOP Protein binds to selenium in the liver and transports it to other tissues, where it is incorporated into selenoproteins. This protein also plays a role in the regulation of selenium levels in the body by functioning as a selenium storage protein. It can bind to excess selenium and prevent its toxic effects, thus protecting the body from selenium overload.

Application of Recombinant Mouse SELENOP Protein

Recombinant Mouse SELENOP Protein has various applications in both research and clinical settings. One of its primary uses is as an antigen in immunoassays to measure selenium levels in biological samples. This protein can also be used as a standard to calibrate the measurement of selenium in various tissues and fluids.

Another application of Recombinant Mouse SELENOP Protein is in the study of selenium metabolism and its role in health and disease. Researchers can use this protein to investigate the effects of selenium deficiency or excess on various physiological processes. It can also be used to study the role of selenoproteins in antioxidant defense, thyroid hormone metabolism, and other biological functions.

In clinical settings, Recombinant Mouse SELENOP Protein has potential therapeutic applications. Studies have shown that low levels of selenium are associated with various diseases, including cancer, cardiovascular disease, and autoimmune disorders. By understanding the role of this protein in selenium transport and regulation, researchers can develop new treatments for these conditions.

Conclusion

In conclusion, Recombinant Mouse SELENOP Protein is a vital protein that plays a crucial role in the body’s antioxidant defense system. Its structure, activity, and application make it a valuable tool in the study of selenium metabolism and its role in health and disease. Further research on this protein may lead to the development of new treatments for various diseases associated with selenium deficiency or excess.

Recombinant Mouse SELENOP Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse SELENOP Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products