Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Mouse IL36A/IL-1F6 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9JLA2
Molecular weight:
20.18 kDa

Original price was: $509.00.Current price is: $392.00.

100ug 23% OFF + 392 loyalty points
Met1–His160
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Mouse IL36A/IL-1F6 Protein, N-His

Recombinant Mouse IL36A/IL-1F6 Protein, N-His

Product name ARO-P11126-100
Uniprot ID Q9JLA2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH
Molecular weight 20.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-His160
Aliases /Synonyms Interleukin-36 alpha, Il1h1, Il36a, Il1e, Interleukin-1 family member 6, Il1f6, IL-1 epsilon, IL-1H1, Fil1e, IL-1F6, Interleukin-1 homolog 1, Interleukin-1 epsilon, FIL1 epsilon
Reference ARO-P11126
Note For research use only.
Molecular Constructor
Met1–His160
Product name ARO-P11126-1MG
Uniprot ID Q9JLA2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH
Molecular weight 20.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-His160
Aliases /Synonyms Interleukin-36 alpha, Il1h1, Il36a, Il1e, Interleukin-1 family member 6, Il1f6, IL-1 epsilon, IL-1H1, Fil1e, IL-1F6, Interleukin-1 homolog 1, Interleukin-1 epsilon, FIL1 epsilon
Reference ARO-P11126
Note For research use only.
Molecular Constructor
Met1–His160
Product name ARO-P11126-50
Uniprot ID Q9JLA2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH
Molecular weight 20.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-His160
Aliases /Synonyms Interleukin-36 alpha, Il1h1, Il36a, Il1e, Interleukin-1 family member 6, Il1f6, IL-1 epsilon, IL-1H1, Fil1e, IL-1F6, Interleukin-1 homolog 1, Interleukin-1 epsilon, FIL1 epsilon
Reference ARO-P11126
Note For research use only.
Molecular Constructor
Met1–His160

Recombinant Mouse IL36A/IL-1F6 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse IL36A/IL-1F6 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products