Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ocankitug Biosimilar – Anti-TSLP mAb – Research Grade

  • PX-TA2179-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $224.00.Current price is: $167.00.

50ug 25% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Ocankitug Biosimilar - Anti-TSLP mAb - Research Grade

Product name PX-TA2179-50
Uniprot ID Q969D9
Source CAS: 2803351-66-6
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-TSLP, Thymic stromal lymphopoietin
Reference PX-TA2179-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Ocankitug Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS: 2803351-66-6
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-TSLP, Thymic stromal lymphopoietin
Reference PX-TA2179-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Ocankitug Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS: 2803351-66-6
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-TSLP, Thymic stromal lymphopoietin
Reference PX-TA2179-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction
Ocankitug Biosimilar is a therapeutic antibody that targets a protein called thymic stromal lymphopoietin (TSLP). This biosimilar is a research grade product that has shown promising results in preclinical studies for the treatment of various inflammatory and allergic diseases. In this article, we will discuss the structure, activity, and potential applications of Ocankitug Biosimilar in detail.

Structure of Ocankitug Biosimilar
Ocankitug Biosimilar is a monoclonal antibody, which means it is derived from a single type of immune cell. It is a biosimilar of an existing therapeutic antibody that has been approved for clinical use. Biosimilars are highly similar versions of already approved biological medicines, with no clinically meaningful differences in terms of safety, purity, and potency. Ocankitug Biosimilar is a recombinant humanized IgG1 monoclonal antibody, which means it is made up of human and mouse components. This structure allows for better binding to the target protein and reduces the risk of immune reactions.

Activity of Ocankitug Biosimilar
TSLP is a cytokine that plays a crucial role in the development of allergic and inflammatory diseases. It is produced by various cell types, including epithelial cells, and has been shown to activate immune cells such as T cells, B cells, and dendritic cells. By targeting TSLP, Ocankitug Biosimilar inhibits its activity and prevents the activation of these immune cells, thus reducing the inflammatory response. This mechanism of action makes Ocankitug Biosimilar a promising therapeutic option for a range of diseases.

Potential Applications of Ocankitug Biosimilar
Ocankitug Biosimilar has shown potential in the treatment of various diseases, including asthma, atopic dermatitis, and allergic rhinitis. In preclinical studies, it has been shown to reduce allergic airway inflammation and improve lung function in animal models of asthma. It has also been shown to reduce skin inflammation and improve skin barrier function in models of atopic dermatitis. These promising results suggest that Ocankitug Biosimilar may be a valuable treatment option for these conditions.

In addition to allergic and inflammatory diseases, Ocankitug Biosimilar has also shown potential in the treatment of autoimmune diseases. TSLP has been linked to the development of autoimmune diseases such as multiple sclerosis and rheumatoid arthritis. By targeting TSLP, Ocankitug Biosimilar may help reduce the activity of immune cells involved in these diseases and improve symptoms. Further research is needed to determine the efficacy of Ocankitug Biosimilar in these conditions.

Conclusion
Ocankitug Biosimilar is a promising therapeutic antibody that targets TSLP, a key player in the development of inflammatory and allergic diseases. Its structure as a recombinant humanized IgG1 monoclonal antibody allows for better binding to the target protein and reduces the risk of immune reactions. Preclinical studies have shown its potential in the treatment of asthma, atopic dermatitis, and other diseases. Further research and clinical trials are needed to determine its efficacy and safety in humans. Ocankitug Biosimilar has the potential to be a valuable treatment option for patients suffering from these diseases.

SDS-PAGE for Ocankitug Biosimilar - Research Grade

SDS-PAGE for Ocankitug Biosimilar - Research Grade

Ocankitug Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SDS-PAGE for Ocankitug Biosimilar - Research Grade

SDS-PAGE for Ocankitug Biosimilar - Research Grade

Ocankitug Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Ocankitug Biosimilar – Anti-TSLP mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products