Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Ostreid herpesvirus Putative apoptosis inhibitor ORF87 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Ostreid herpesvirus
Uniprot ID:
Q6R7E2
Molecular weight:
21,69 kDa

$392.00

100ug + 392 loyalty points
Full-length Yes
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Ostreid herpesvirus Putative apoptosis inhibitor ORF87 Recombinant Protein

Ostreid herpesvirus Putative apoptosis inhibitor ORF87 Recombinant Protein

Product name Ostreid herpesvirus Putative apoptosis inhibitor ORF87 Recombinant Protein
Uniprot ID Q6R7E2
Uniprot link http://www.uniprot.org/uniprot/Q6R7E2
Origin species Ostreid herpesvirus
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMDIVPISPYERMRPLRESKELRIKSFDDHRWPHKNNPVMTKNMIENYFYYIGINDKIQCVHCGGVISGF LEEDTHRISYEHRRHFPKCPVGKYRHPGYHLDAERLKSFKNWRYENIVRKMDLVAAGLFYTGIEDRCACHQCGNELYEWE AGDNPKEEHKRLFPDCKLSSY
Molecular weight 21,69 kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Buffer PBS, Urea 6M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession YP_024626.1
Spec:Entrez GeneID 2948187
Spec:SwissProtID Q6R7E2
NCBI Reference YP_024626.1
Aliases /Synonyms ORF87, ORF87
Reference PX-P1133
Note For research use only
Molecular Constructor
Full-length Yes
Product name Ostreid herpesvirus Putative apoptosis inhibitor ORF87 Recombinant Protein
Uniprot ID Q6R7E2
Uniprot link http://www.uniprot.org/uniprot/Q6R7E2
Origin species Ostreid herpesvirus
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMDIVPISPYERMRPLRESKELRIKSFDDHRWPHKNNPVMTKNMIENYFYYIGINDKIQCVHCGGVISGF LEEDTHRISYEHRRHFPKCPVGKYRHPGYHLDAERLKSFKNWRYENIVRKMDLVAAGLFYTGIEDRCACHQCGNELYEWE AGDNPKEEHKRLFPDCKLSSY
Molecular weight 21,69 kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Buffer PBS, Urea 6M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession YP_024626.1
Spec:Entrez GeneID 2948187
Spec:SwissProtID Q6R7E2
NCBI Reference YP_024626.1
Aliases /Synonyms ORF87, ORF87
Reference PX-P1133
Note For research use only
Molecular Constructor
Full-length Yes

There are no reviews yet.

Be the first to review “Ostreid herpesvirus Putative apoptosis inhibitor ORF87 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products