Brand: ProteoGenix

Parsatuzumab Biosimilar – Anti-EGFL7 mAb – Research Grade

PX-TA1300-50
Validated ELISA

Clonality:: Monoclonal Antibody
Isotype:: IgG1, kappa

Original price was: $417.00.Current price is: $308.00.

50ug 26% OFF + 308 loyalty points

Size Size

50ug Original price was: $417.00.Current price is: $308.00.
100ug Original price was: $585.00.Current price is: $440.00.
1MG Original price was: $612.00.Current price is: $482.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Parsatuzumab Biosimilar - Anti-EGFL7 mAb - Research Grade binds to Recombinant Human EGFL7, N-His in ELISA Assay

Parsatuzumab Biosimilar - Anti-EGFL7 mAb - Research Grade

Product name	Parsatuzumab Biosimilar - Anti-EGFL7 mAb - Research Grade
Uniprot ID	Q9UHF1
Source	CAS 1312797-14-0
Species	Humanized
Raw Antigen Sequence	MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB
Aliases /Synonyms	Parsatuzumab,RG7414,RO5490248,EGFL7,anti-EGFL7
Reference	PX-TA1300
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1-kappa
Clonality	Monoclonal Antibody

Product name	Parsatuzumab Biosimilar - Anti-EGFL7 mAb - Research Grade
Uniprot ID	Q9UHF1
Source	CAS 1312797-14-0
Species	Humanized
Raw Antigen Sequence	MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB,,,
Aliases /Synonyms	Parsatuzumab,RG7414,RO5490248,EGFL7,anti-EGFL7
Reference	PX-TA1300
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1-kappa
Clonality	Monoclonal Antibody

Product name	PX-TA1300-50
Uniprot ID	Q9UHF1
Source	CAS 1312797-14-0
Species	Humanized
Raw Antigen Sequence	MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Aliases /Synonyms	Parsatuzumab,RG7414,RO5490248,EGFL7,anti-EGFL7
Reference	PX-TA1300
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody

General information on Anti-EGFL7[Homo sapiens] (Parsatuzumab) Monoclonal Antibody

Parsatuzumab is investigated for the treatment of Advanced or Recurrent Non-Squamous Non-Small Cell Lung Cancer.

Parsatuzumab Biosimilar - Anti-EGFL7 mAb - Research Grade binds to Recombinant Human EGFL7, N-His in ELISA Assay

Recombinant Human EGFL7, N-His(cat. No.ARO-P13030) at 0.5Âµg/mL (100ÂµL/well) can bind Parsatuzumab Biosimilar - Anti-EGFL7 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Parsatuzumab Biosimilar - Anti-EGFL7 mAb - Research Grade

Parsatuzumab Biosimilar - Anti-EGFL7 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Parsatuzumab Biosimilar – Anti-EGFL7 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Parsatuzumab Biosimilar – Anti-EGFL7 mAb – Research Grade

Parsatuzumab Biosimilar - Anti-EGFL7 mAb - Research Grade

General information on Anti-EGFL7[Homo sapiens] (Parsatuzumab) Monoclonal Antibody

Parsatuzumab Biosimilar - Anti-EGFL7 mAb - Research Grade binds to Recombinant Human EGFL7, N-His in ELISA Assay

SDS-PAGE for Parsatuzumab Biosimilar - Anti-EGFL7 mAb - Research Grade

Related products

Human IgG1 LALA Isotype Control antibody (HyHEL-10)

InVivoMAb Anti-Human EGFL7 Antibody (Iv0163)

Anti-EGFL7 Polyclonal Antibody

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Parsatuzumab Biosimilar – Anti-EGFL7 mAb – Research Grade

Specifications Parsatuzumab Biosimilar - Anti-EGFL7 mAb - Research Grade

Description

General information on Anti-EGFL7[Homo sapiens] (Parsatuzumab) Monoclonal Antibody

Documents

QC & Validation

Parsatuzumab Biosimilar - Anti-EGFL7 mAb - Research Grade binds to Recombinant Human EGFL7, N-His in ELISA Assay

SDS-PAGE for Parsatuzumab Biosimilar - Anti-EGFL7 mAb - Research Grade

3D Representation

Reviews

Related products

Human IgG1 LALA Isotype Control antibody (HyHEL-10)

InVivoMAb Anti-Human EGFL7 Antibody (Iv0163)

Anti-EGFL7 Polyclonal Antibody

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Parsatuzumab Biosimilar - Anti-EGFL7 mAb - Research Grade