Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

PelB-DN1-ST (virer PelB) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P16455
Molecular weight:
37.88 kDa

Original price was: $342.00.Current price is: $308.00.

50ug 10% OFF + 308 loyalty points
Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

PelB-DN1-ST (virer PelB) Recombinant Protein

Product name PelB-DN1-ST (virer PelB) Recombinant Protein
Uniprot ID P16455
Uniprot link http://www.uniprot.org/uniprot/P16455
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAGSQVQLVQSGGGLVQAGGSLRLSCAASGRTFSSFAMAWFRQAPGKEREFVAAISWSGSTGHADSVKGRFTITRDNAKNTVFLQMNSLKPEDTAVYYCALGKGSSYYYSPSGYDYWGQGTQVTVSSGGSGGGSGGSDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWK
Molecular weight 37.88 kDa
Protein delivered with Tag? Yes
Purity estimated 10%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Protein Accession AFU51890.1
Spec:Entrez GeneID 4255
Spec:SwissProtID P16455
NCBI Reference AFU51890.1
Aliases /Synonyms PelB-DN1-ST (virer PelB), O-6-methylguanine-DNA methyltransferase, SNAP-XDocII fusion protein
Reference PX-P2086
Note For research use only
Molecular Constructor
Yes
Product name PelB-DN1-ST (virer PelB) Recombinant Protein
Uniprot ID P16455
Uniprot link http://www.uniprot.org/uniprot/P16455
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAGSQVQLVQSGGGLVQAGGSLRLSCAASGRTFSSFAMAWFRQAPGKEREFVAAISWSGSTGHADSVKGRFTITRDNAKNTVFLQMNSLKPEDTAVYYCALGKGSSYYYSPSGYDYWGQGTQVTVSSGGSGGGSGGSDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWK
Molecular weight 37.88 kDa
Protein delivered with Tag? Yes
Purity estimated 10%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Protein Accession AFU51890.1
Spec:Entrez GeneID 4255
Spec:SwissProtID P16455
NCBI Reference AFU51890.1
Aliases /Synonyms PelB-DN1-ST (virer PelB), O-6-methylguanine-DNA methyltransferase, SNAP-XDocII fusion protein
Reference PX-P2086
Note For research use only
Molecular Constructor
Yes
Product name PX-P2086-1MG
Uniprot ID P16455
Uniprot link http://www.uniprot.org/uniprot/P16455
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAGSQVQLVQSGGGLVQAGGSLRLSCAASGRTFSSFAMAWFRQAPGKEREFVAAISWSGSTGHADSVKGRFTITRDNAKNTVFLQMNSLKPEDTAVYYCALGKGSSYYYSPSGYDYWGQGTQVTVSSGGSGGGSGGSDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWK
Molecular weight 37.88 kDa
Protein delivered with Tag? Yes
Purity estimated 10%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Protein Accession AFU51890.1
Spec:Entrez GeneID 4255
Spec:SwissProtID P16455
NCBI Reference AFU51890.1
Aliases /Synonyms PelB-DN1-ST (virer PelB), O-6-methylguanine-DNA methyltransferase, SNAP-XDocII fusion protein
Reference PX-P2086
Note For research use only
Molecular Constructor
Yes

PelB-DN1-ST (virer PelB) Recombinant Protein

  • Waller BH, Olson DG, Currie DH, Guss AM, Lynd LR. Exchange of type II dockerin-containing subunits of the Clostridium thermocellum cellulosome as revealed by SNAP-tags. FEMS Microbiol Lett. 2013 Jan;338(1):46-53. doi: 10.1111/1574-6968.12029. Epub 2012 Nov 30. PubMed PMID: 23082914.

There are no reviews yet.

Be the first to review “PelB-DN1-ST (virer PelB) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products