Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

PelB-DN1-ST (virer PelB) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P16455
Molecular weight:
37.88 kDa

$587.00

+ 587 loyalty points
Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
PelB-DN1-ST (virer PelB) Recombinant Protein

PelB-DN1-ST (virer PelB) Recombinant Protein

Product name PelB-DN1-ST (virer PelB) Recombinant Protein
Uniprot ID P16455
Uniprot link http://www.uniprot.org/uniprot/P16455
Expression system Prokaryotic expression
Sequence MKYLLPTAAAGLLLLAAQPAGSQVQLVQSGGGLVQAGGSLRLSCAASGRTFSSFAMAWFRQAPGKEREFVAAISWSGSTGHADSVKGRFTITRDNAKNTVFLQMNSLKPEDTAVYYCALGKGSSYYYSPSGYDYWGQGTQVTVSSGGSGGGSGGSDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWK
Molecular weight 37.88 kDa
Protein delivered with Tag? Yes
Purity estimated 10%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Protein Accession AFU51890.1
Spec:Entrez GeneID 4255
Spec:SwissProtID P16455
NCBI Reference AFU51890.1
Aliases /Synonyms PelB-DN1-ST (virer PelB), O-6-methylguanine-DNA methyltransferase, SNAP-XDocII fusion protein
Reference PX-P2086
Note For research use only
Molecular Constructor
Yes
Product name PelB-DN1-ST (virer PelB) Recombinant Protein
Uniprot ID P16455
Uniprot link http://www.uniprot.org/uniprot/P16455
Expression system Prokaryotic expression
Sequence MKYLLPTAAAGLLLLAAQPAGSQVQLVQSGGGLVQAGGSLRLSCAASGRTFSSFAMAWFRQAPGKEREFVAAISWSGSTGHADSVKGRFTITRDNAKNTVFLQMNSLKPEDTAVYYCALGKGSSYYYSPSGYDYWGQGTQVTVSSGGSGGGSGGSDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWK
Molecular weight 37.88 kDa
Protein delivered with Tag? Yes
Purity estimated 10%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Protein Accession AFU51890.1
Spec:Entrez GeneID 4255
Spec:SwissProtID P16455
NCBI Reference AFU51890.1
Aliases /Synonyms PelB-DN1-ST (virer PelB), O-6-methylguanine-DNA methyltransferase, SNAP-XDocII fusion protein
Reference PX-P2086
Note For research use only
Molecular Constructor
Yes

  • Waller BH, Olson DG, Currie DH, Guss AM, Lynd LR. Exchange of type II dockerin-containing subunits of the Clostridium thermocellum cellulosome as revealed by SNAP-tags. FEMS Microbiol Lett. 2013 Jan;338(1):46-53. doi: 10.1111/1574-6968.12029. Epub 2012 Nov 30. PubMed PMID: 23082914.

There are no reviews yet.

Be the first to review “PelB-DN1-ST (virer PelB) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products