Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Peptidoglycan hydrolase

Host species:
Bacillus subtilis
Origin species:
Thermus phage TSP4
Uniprot ID:
A0A411CWC0 

$250.00

50ug + 250 loyalty points
Met1–Lys166 His
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Peptidoglycan hydrolase

Product name Peptidoglycan hydrolase
Uniprot ID A0A411CWC0 
Origin species Thermus phage TSP4
Expression system Prokaryotic expression
Sequence MRLPTKTSRFGYVHGQRNHEGIPHPGYDLNNGPTPTSDLGQPVYAPEDGVVVYARTGSGTWGGLVVVLGKSGFAHRLGHVRNIRVKEGQEVKEGQQVAEIGEFVKGLPHLHYDMVEPKVIHTISILIKAPYVRWDFWHVNFPKLFEHMYVDPARFHPELAKLLGGKGSHHHHHH
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Bacillus subtilis
Fragment Type Met1-Lys166
Reference PX-P4658
Note For research use only
Molecular Constructor
Met1–Lys166 His
Product name Peptidoglycan hydrolase
Uniprot ID A0A411CWC0 
Origin species Thermus phage TSP4
Expression system Prokaryotic expression
Sequence MRLPTKTSRFGYVHGQRNHEGIPHPGYDLNNGPTPTSDLGQPVYAPEDGVVVYARTGSGTWGGLVVVLGKSGFAHRLGHVRNIRVKEGQEVKEGQQVAEIGEFVKGLPHLHYDMVEPKVIHTISILIKAPYVRWDFWHVNFPKLFEHMYVDPARFHPELAKLLGGKGSHHHHHH
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Bacillus subtilis
Fragment Type Met1-Lys166
Reference PX-P4658
Note For research use only
Molecular Constructor
Met1–Lys166 His

There are no reviews yet.

Be the first to review “Peptidoglycan hydrolase”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products