Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Pivekimab Biosimilar – Anti-IL3RA mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $209.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Pivekimab Biosimilar - Anti-IL3RA mAb - Research Grade

Product name Pivekimab Biosimilar - Anti-IL3RA mAb - Research Grade
Uniprot ID P26951
Source CAS: 2234335-84-1
Species Humanized
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Pivekimab,G4723A,IL3RA,anti-IL3RA
Reference PX-TA1769
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Pivekimab Biosimilar - Anti-IL3RA mAb - Research Grade
Uniprot ID P26951
Source CAS: 2234335-84-1
Species Humanized
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Pivekimab,G4723A,IL3RA,anti-IL3RA
Reference PX-TA1769
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1769-50
Uniprot ID P26951
Source CAS: 2234335-84-1
Species Humanized
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Pivekimab,G4723A,IL3RA,anti-IL3RA
Reference PX-TA1769
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Pivekimab Biosimilar – Anti-IL3RA mAb – Research Grade: A Promising Antibody Targeting IL3RA for Therapeutic Use

Introduction

Pivekimab Biosimilar is a monoclonal antibody (mAb) that specifically targets the Interleukin-3 Receptor Alpha (IL3RA). This mAb is a biosimilar version of the original Pivekimab, which is a humanized IgG1 antibody. Pivekimab Biosimilar is a promising therapeutic agent that has shown potential in the treatment of various diseases, including cancer and autoimmune disorders. In this article, we will explore the structure, activity, and application of Pivekimab Biosimilar as a research-grade antibody.

Structure of Pivekimab Biosimilar

Pivekimab Biosimilar is a recombinant humanized IgG1 antibody, which means that it is derived from human antibodies and modified to have a longer half-life in the body. It has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of two constant domains (CL and CL’) and one variable domain (VL). The variable domains of both the heavy and light chains are responsible for the specificity of the antibody, as they bind to the target antigen, IL3RA.

Activity of Pivekimab Biosimilar

Pivekimab Biosimilar binds specifically to IL3RA, which is a cell surface protein that is expressed on various immune cells, including T cells, B cells, and natural killer cells. IL3RA is also overexpressed on the surface of cancer cells, making it an attractive therapeutic target. By binding to IL3RA, Pivekimab Biosimilar blocks the interaction between IL3RA and its ligand, Interleukin-3 (IL-3). This prevents the activation of downstream signaling pathways that promote cell proliferation and survival, leading to the inhibition of tumor growth.

In addition, Pivekimab Biosimilar also has an antibody-dependent cell-mediated cytotoxicity (ADCC) activity. This means that it can bind to IL3RA-expressing cells and recruit immune cells, such as natural killer cells, to kill the target cells. This mechanism of action makes Pivekimab Biosimilar a potent therapeutic agent for the treatment of cancer.

Application of Pivekimab Biosimilar

Pivekimab Biosimilar is currently being investigated for its potential use in the treatment of various diseases, including acute myeloid leukemia (AML), chronic myeloid leukemia (CML), and multiple myeloma (MM). These diseases are characterized by the overexpression of IL3RA on the surface of cancer cells, making them ideal targets for Pivekimab Biosimilar. In preclinical studies, Pivekimab Biosimilar has shown promising results in inhibiting tumor growth and inducing cell death in IL3RA-expressing cancer cells.

Moreover, Pivekimab Biosimilar has also shown potential in the treatment of autoimmune disorders, such as rheumatoid arthritis and psoriasis. IL3RA has been implicated in the pathogenesis of these diseases, and targeting it with Pivekimab Biosimilar may provide a new therapeutic approach.

Conclusion

In summary, Pivekimab Biosimilar is a promising research-grade antibody that specifically targets IL3RA. Its unique structure and activity make it a potent therapeutic agent for the treatment of various diseases, including cancer and autoimmune disorders. Further studies and clinical trials are needed to fully explore the potential of Pivekimab Biosimilar in the field of medicine. However, its potential as a therapeutic antibody targeting IL3RA holds great promise for the future of healthcare.

SDS-PAGE for Pivekimab Biosimilar - Anti-IL3RA mAb - Research Grade

SDS-PAGE for Pivekimab Biosimilar - Anti-IL3RA mAb - Research Grade

Pivekimab Biosimilar - Anti-IL3RA mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Pivekimab Biosimilar - Anti-IL3RA mAb - Research Grade

There are no reviews yet.

Be the first to review “Pivekimab Biosimilar – Anti-IL3RA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products