Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Cat CD279/PDCD1/PD1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Cat
Uniprot ID:
NP_001138982.1
Molecular weight:
18.55 kDa

Original price was: $446.00.Current price is: $392.00.

100ug 12% OFF + 392 loyalty points
Leu25–Leu169
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Recombinant Cat CD279/PDCD1/PD1 Protein, N-His

Recombinant Cat CD279/PDCD1/PD1 Protein, N-His

Product name ARO-P10236-100
Uniprot ID NP_001138982.1
Origin species Cat
Expression system Prokaryotic expression
Raw Antigen Sequence LDSPYRPWSPLTFSPAQLTVLEGENATFVCHLPDVPESFVLNWYRVSPRNQTDKLAAFQENHTEPGKDRRFRVTRLPSGQDFHTTILAAQLNDSGIYLCGAIYLPPNTQIYESPRAELTVKERVLEPPTESPSPPPRLTGQGQGL
Molecular weight 18.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu25-Leu169
Aliases /Synonyms programmed cell death protein 1 precursor, PDCD1
Reference ARO-P10236
Note For research use only.
Molecular Constructor
Leu25–Leu169
Product name ARO-P10236-1MG
Uniprot ID NP_001138982.1
Origin species Cat
Expression system Prokaryotic expression
Raw Antigen Sequence LDSPYRPWSPLTFSPAQLTVLEGENATFVCHLPDVPESFVLNWYRVSPRNQTDKLAAFQENHTEPGKDRRFRVTRLPSGQDFHTTILAAQLNDSGIYLCGAIYLPPNTQIYESPRAELTVKERVLEPPTESPSPPPRLTGQGQGL
Molecular weight 18.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu25-Leu169
Aliases /Synonyms programmed cell death protein 1 precursor, PDCD1
Reference ARO-P10236
Note For research use only.
Molecular Constructor
Leu25–Leu169
Product name ARO-P10236-50
Uniprot ID NP_001138982.1
Origin species Cat
Expression system Prokaryotic expression
Raw Antigen Sequence LDSPYRPWSPLTFSPAQLTVLEGENATFVCHLPDVPESFVLNWYRVSPRNQTDKLAAFQENHTEPGKDRRFRVTRLPSGQDFHTTILAAQLNDSGIYLCGAIYLPPNTQIYESPRAELTVKERVLEPPTESPSPPPRLTGQGQGL
Molecular weight 18.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu25-Leu169
Aliases /Synonyms programmed cell death protein 1 precursor, PDCD1
Reference ARO-P10236
Note For research use only.
Molecular Constructor
Leu25–Leu169

SDS-PAGE for Recombinant Cat CD279/PDCD1/PD1 Protein, N-His

SDS-PAGE for Recombinant Cat CD279/PDCD1/PD1 Protein, N-His

Recombinant Cat CD279/PDCD1/PD1 Protein, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Recombinant Cat CD279/PDCD1/PD1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products