Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant DENV-3 Envelope protein E, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Dengue virus type 3 (strain Philippines/H87/1956) (DENV-3)
Uniprot ID:
P27915
Molecular weight:
13.55 kDa

Original price was: $350.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Met575–Lys678
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant DENV-3 Envelope protein E, N-His

Product name ARO-P12714-100
Uniprot ID P27915
Origin species Dengue virus type 3 (strain Philippines/H87/1956) (DENV-3)
Expression system Prokaryotic expression
Raw Antigen Sequence MSYAMCLNTFVLKKEVSETQHGTILIKVEYKGEDAPCKIPFSTEDGQGKAHNGRLITANPVVTKKEEPVNIEAEPPFGESNIVIGIGDKALKINWYRKGSSIGK
Molecular weight 13.55 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met575-Lys678
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-P12714
Note For research use only.
Molecular Constructor
Met575–Lys678
Product name ARO-P12714-1MG
Uniprot ID P27915
Origin species Dengue virus type 3 (strain Philippines/H87/1956) (DENV-3)
Expression system Prokaryotic expression
Raw Antigen Sequence MSYAMCLNTFVLKKEVSETQHGTILIKVEYKGEDAPCKIPFSTEDGQGKAHNGRLITANPVVTKKEEPVNIEAEPPFGESNIVIGIGDKALKINWYRKGSSIGK
Molecular weight 13.55 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met575-Lys678
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-P12714
Note For research use only.
Molecular Constructor
Met575–Lys678
Product name ARO-P12714-50
Uniprot ID P27915
Origin species Dengue virus type 3 (strain Philippines/H87/1956) (DENV-3)
Expression system Prokaryotic expression
Raw Antigen Sequence MSYAMCLNTFVLKKEVSETQHGTILIKVEYKGEDAPCKIPFSTEDGQGKAHNGRLITANPVVTKKEEPVNIEAEPPFGESNIVIGIGDKALKINWYRKGSSIGK
Molecular weight 13.55 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met575-Lys678
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-P12714
Note For research use only.
Molecular Constructor
Met575–Lys678

Introduction

Recombinant DENV-3 Envelope protein E is a synthetic protein that is derived from the envelope protein of Dengue virus serotype 3 (DENV-3). This protein has been genetically engineered in the laboratory to mimic the natural structure and function of the envelope protein found on the surface of the virus. Recombinant protein technology has allowed for the production of large quantities of this protein, which has been extensively studied for its potential use as an antigen in diagnostics and vaccine development.

Structure of Recombinant DENV-3 Envelope protein E

The structure of Recombinant DENV-3 Envelope protein E closely resembles that of the natural envelope protein found on the surface of DENV-3. It is composed of 495 amino acids and has a molecular weight of approximately 55 kDa. The protein has three distinct domains – domain I, II, and III – that are responsible for different functions. Domain I is involved in receptor binding, domain II is involved in fusion of the virus with host cells, and domain III is involved in virus assembly and maturation.

Activity of Recombinant DENV-3 Envelope protein E

Recombinant DENV-3 Envelope protein E is a highly active protein that plays a crucial role in the pathogenesis of DENV-3. It is responsible for the attachment and entry of the virus into host cells, as well as for the production of neutralizing antibodies in the host. The protein is also involved in the formation of viral particles and their release from infected cells. In addition, Recombinant DENV-3 Envelope protein E has been shown to induce a strong immune response in the host, making it a potential target for vaccine development.

Application of Recombinant DENV-3 Envelope protein E

Recombinant DENV-3 Envelope protein E has several potential applications in the field of dengue research and diagnostics. One of its main applications is as an antigen in diagnostic tests for the detection of DENV-3 infection. The protein can be used in serological assays, such as ELISA and Western blot, for the detection of antibodies against DENV-3 in patient serum. It can also be used in rapid diagnostic tests, such as lateral flow assays, for quick and accurate detection of DENV-3 infection.

Another important application of Recombinant DENV-3 Envelope protein E is in the development of dengue vaccines. The protein has been extensively studied as a potential vaccine candidate, and several studies have shown promising results. Recombinant DENV-3 Envelope protein E can be used as a subunit vaccine, where it is combined with other viral proteins to induce a strong immune response against DENV-3. It can also be used as a live attenuated vaccine, where the protein is incorporated into a weakened form of the virus that can stimulate the immune system without causing disease.

In addition to its diagnostic and vaccine applications, Recombinant DENV-3 Envelope protein E has also been studied for its potential use in therapeutic interventions. The protein has been shown to have antiviral properties, and it may be used in the development of antiviral drugs to treat dengue infections. Furthermore, Recombinant DENV-3 Envelope protein E can also be used in research studies to better understand the structure and function of the protein and its role in dengue virus infection.

Conclusion

In summary, Recombinant DENV-3 Envelope protein E is a synthetic protein that closely resembles the natural envelope protein found on the surface of DENV-3. It plays a crucial role in the pathogenesis of dengue and has several potential applications in diagnostics, vaccine development, and therapeutic interventions. Further research and development of this protein may lead to improved methods for the diagnosis, prevention, and treatment of dengue virus infection.

Recombinant DENV-3 Envelope protein E, N-His

There are no reviews yet.

Be the first to review “Recombinant DENV-3 Envelope protein E, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products