Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Hepatitis E virus genotype 1 (isolate Human/Pakistan/Sar-55) (HEV-1)
Uniprot ID:
P33426
Molecular weight:
17.77 kDa

Original price was: $350.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Ser459–Pro603
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein, N-His

Product name ARO-P12638-100
Uniprot ID P33426
Origin species Hepatitis E virus genotype 1 (isolate Human/Pakistan/Sar-55) (HEV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence SRPFSVLRANDVLWLSLTAAEYDQSTYGSSTGPVYVSDSVTLVNVATGAQAVARSLDWTKVTLDGRPLSTIQQYSKTFFVLPLRGKLSFWEAGTTKAGYPYNYNTTASDQLLVENAAGHRVAISTYTTSLGAGPVSISAVAVLAP
Molecular weight 17.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser459-Pro603
Aliases /Synonyms Secreted protein ORF2; Protein ORF2; pORF2; ORF2, Hepatitis E virus (HEV)
Reference ARO-P12638
Note For research use only.
Molecular Constructor
Ser459–Pro603
Product name ARO-P12638-1MG
Uniprot ID P33426
Origin species Hepatitis E virus genotype 1 (isolate Human/Pakistan/Sar-55) (HEV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence SRPFSVLRANDVLWLSLTAAEYDQSTYGSSTGPVYVSDSVTLVNVATGAQAVARSLDWTKVTLDGRPLSTIQQYSKTFFVLPLRGKLSFWEAGTTKAGYPYNYNTTASDQLLVENAAGHRVAISTYTTSLGAGPVSISAVAVLAP
Molecular weight 17.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser459-Pro603
Aliases /Synonyms Secreted protein ORF2; Protein ORF2; pORF2; ORF2, Hepatitis E virus (HEV)
Reference ARO-P12638
Note For research use only.
Molecular Constructor
Ser459–Pro603
Product name ARO-P12638-50
Uniprot ID P33426
Origin species Hepatitis E virus genotype 1 (isolate Human/Pakistan/Sar-55) (HEV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence SRPFSVLRANDVLWLSLTAAEYDQSTYGSSTGPVYVSDSVTLVNVATGAQAVARSLDWTKVTLDGRPLSTIQQYSKTFFVLPLRGKLSFWEAGTTKAGYPYNYNTTASDQLLVENAAGHRVAISTYTTSLGAGPVSISAVAVLAP
Molecular weight 17.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser459-Pro603
Aliases /Synonyms Secreted protein ORF2; Protein ORF2; pORF2; ORF2, Hepatitis E virus (HEV)
Reference ARO-P12638
Note For research use only.
Molecular Constructor
Ser459–Pro603

Title: Introduction to Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein

Hepatitis E virus (HEV) is a major cause of acute hepatitis in developing countries, with an estimated 20 million infections and 70,000 deaths annually. It is a single-stranded RNA virus that belongs to the family Hepeviridae. HEV is classified into four genotypes, with genotypes 1 and 2 being the main cause of human infections. The virus is transmitted through the fecal-oral route and can cause both sporadic and epidemic outbreaks. Currently, there is no specific treatment for HEV infection, and the development of an effective vaccine is crucial in controlling the disease. Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein is a promising candidate for vaccine development against HEV. In this article, we will provide a scientific description of the structure, activity, and application of this recombinant protein.

Title: Structure of Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein

The genome of HEV consists of three open reading frames (ORFs), with ORF2 encoding the capsid protein. The capsid protein is essential for virus assembly and is the main target for neutralizing antibodies. Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein is a recombinant form of the capsid protein, which is produced using genetic engineering techniques. The protein is expressed in a host cell, such as Escherichia coli, and purified to obtain a highly pure and stable form. The recombinant protein has a molecular weight of approximately 72 kDa and consists of 660 amino acids. It shares a high degree of sequence homology with the native capsid protein of HEV-1, making it an ideal candidate for vaccine development.

Title: Activity of Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein

The main activity of Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein is its ability to induce a protective immune response against HEV infection. The protein is highly immunogenic and can elicit both humoral and cellular immune responses. Studies have shown that the recombinant protein can stimulate the production of neutralizing antibodies, which can prevent virus entry and replication. Additionally, the protein can also activate T-cells, which play a crucial role in clearing the virus from the body. The activity of the recombinant protein has been demonstrated in both animal models and human clinical trials, making it a promising candidate for vaccine development.

Title: Application of Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein

Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein has several potential applications, with the most significant being its use as a vaccine against HEV infection. The recombinant protein can be formulated with adjuvants and delivered via different routes, such as intramuscular, intranasal, or oral administration. Clinical trials have shown that the protein is safe and can induce a robust immune response in humans. It has also been shown to provide long-term protection against HEV infection. In addition to its use as a vaccine, the recombinant protein can also be used in diagnostic assays for the detection of HEV-specific antibodies. Furthermore, it can also be used in research studies to understand the immunological mechanisms involved in HEV infection and to develop new treatment strategies.

In conclusion, Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein is a promising candidate for vaccine development against HEV infection. Its well-defined structure, potent activity, and potential applications make it a valuable tool in the fight against this significant public health concern. Further research and development of this recombinant protein can lead to the development of an effective vaccine that can prevent the spread of HEV and save thousands of lives.

Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products