Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ADIPOR2, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q86V24
Molecular weight:
19.33 kDa

Original price was: $328.00.Current price is: $274.00.

50ug 16% OFF + 274 loyalty points
Met1–Gly147
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ADIPOR2, N-His

Product name ARO-P13269-100
Uniprot ID Q86V24
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETG
Molecular weight 19.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly147
Aliases /Synonyms Adiponectin receptor protein 2, ADIPOR2, PAQR2, Progestin and adipoQ receptor family member 2, Progestin and adipoQ receptor family member II
Reference ARO-P13269
Note For research use only.
Molecular Constructor
Met1–Gly147
Product name ARO-P13269-1MG
Uniprot ID Q86V24
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETG
Molecular weight 19.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly147
Aliases /Synonyms Adiponectin receptor protein 2, ADIPOR2, PAQR2, Progestin and adipoQ receptor family member 2, Progestin and adipoQ receptor family member II
Reference ARO-P13269
Note For research use only.
Molecular Constructor
Met1–Gly147
Product name ARO-P13269-50
Uniprot ID Q86V24
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETG
Molecular weight 19.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly147
Aliases /Synonyms Adiponectin receptor protein 2, ADIPOR2, PAQR2, Progestin and adipoQ receptor family member 2, Progestin and adipoQ receptor family member II
Reference ARO-P13269
Note For research use only.
Molecular Constructor
Met1–Gly147

Introduction to Recombinant Human ADIPOR2

Recombinant Human ADIPOR2, also known as Adiponectin Receptor 2, is a protein that plays a crucial role in regulating metabolism and energy homeostasis. It is a member of the Adiponectin Receptor family, which also includes ADIPOR1. ADIPOR2 is a transmembrane protein that is primarily expressed in adipose tissue, but can also be found in other tissues such as skeletal muscle, liver, and heart.

Structure of Recombinant Human ADIPOR2

The gene for ADIPOR2 is located on chromosome 12 in humans and consists of 8 exons. The protein is composed of 386 amino acids and has a molecular weight of approximately 44 kDa. ADIPOR2 has a single transmembrane domain and a large extracellular domain that contains a conserved cysteine-rich region. This region is important for ligand binding and receptor activation. The intracellular domain of ADIPOR2 contains a conserved motif known as the Lysine-Arginine-X (KRX) motif, which is essential for downstream signaling.

Activity of Recombinant Human ADIPOR2

ADIPOR2 is a receptor for the hormone adiponectin, which is secreted by adipose tissue and has anti-inflammatory and insulin-sensitizing effects. When adiponectin binds to ADIPOR2, it induces a conformational change in the receptor, leading to the activation of downstream signaling pathways. This results in the regulation of various metabolic processes, including glucose and lipid metabolism, as well as insulin sensitivity.

ADIPOR2 has also been shown to have a role in regulating inflammation and oxidative stress. Studies have found that ADIPOR2 activation can inhibit the production of pro-inflammatory cytokines and increase the expression of anti-inflammatory cytokines. This suggests that ADIPOR2 may have potential therapeutic applications in inflammatory diseases.

Application of Recombinant Human ADIPOR2

Recombinant Human ADIPOR2 has been widely used in research to study the role of adiponectin signaling in various physiological and pathological conditions. It has also been used in drug discovery and development, as targeting ADIPOR2 may have therapeutic potential for metabolic disorders such as obesity, type 2 diabetes, and cardiovascular diseases.

One potential application of Recombinant Human ADIPOR2 is in the development of therapeutics for obesity. Studies have shown that ADIPOR2 activation can improve insulin sensitivity and promote weight loss. This makes it a potential target for the treatment of obesity and related metabolic disorders.

Another potential application of Recombinant Human ADIPOR2 is in the treatment of type 2 diabetes. ADIPOR2 has been found to be downregulated in individuals with type 2 diabetes, and its activation has been shown to improve insulin sensitivity and glucose metabolism. This suggests that targeting ADIPOR2 may be a promising approach for the management of type 2 diabetes.

Furthermore, ADIPOR2 has been implicated in cardiovascular diseases such as atherosclerosis and heart failure. Studies have shown that ADIPOR2 activation can improve cardiac function and reduce inflammation and oxidative stress in the heart. This makes it a potential therapeutic target for the prevention and treatment of cardiovascular diseases.

Conclusion

In summary, Recombinant Human ADIPOR2 is an important protein involved in regulating metabolism, inflammation, and oxidative stress. Its structure, activity, and potential applications make it a valuable tool in research and drug discovery. Further studies on ADIPOR2 and its signaling pathways may lead to the development of novel therapeutics for various metabolic and inflammatory diseases.

Recombinant Human ADIPOR2, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ADIPOR2, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products