Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ARHGAP10 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
A1A4S6
Molecular weight:
23.23 kDa

Original price was: $334.00.Current price is: $274.00.

50ug 18% OFF + 274 loyalty points
Asp392–Thr576
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ARHGAP10 Protein, N-His

Product name ARO-P11605-100
Uniprot ID A1A4S6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DKMGFTIIRKCISAVETRGINDQGLYRVVGVSSKVQRLLSMLMDVKTCNEVDLENSADWEVKTITSALKQYLRSLPEPLMTYELHGDFIVPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGPTLMRPQEETVAALMDLKFQNIVVEILIENHEKIFRT
Molecular weight 23.23 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp392-Thr576
Aliases /Synonyms Graf-related protein 2, GTPase regulator associated with focal adhesion kinase 2, ARHGAP10, GRAF2, Rho GTPase-activating protein 10, Rho-type GTPase-activating protein 10
Reference ARO-P11605
Note For research use only.
Molecular Constructor
Asp392–Thr576
Product name ARO-P11605-1MG
Uniprot ID A1A4S6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DKMGFTIIRKCISAVETRGINDQGLYRVVGVSSKVQRLLSMLMDVKTCNEVDLENSADWEVKTITSALKQYLRSLPEPLMTYELHGDFIVPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGPTLMRPQEETVAALMDLKFQNIVVEILIENHEKIFRT
Molecular weight 23.23 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp392-Thr576
Aliases /Synonyms Graf-related protein 2, GTPase regulator associated with focal adhesion kinase 2, ARHGAP10, GRAF2, Rho GTPase-activating protein 10, Rho-type GTPase-activating protein 10
Reference ARO-P11605
Note For research use only.
Molecular Constructor
Asp392–Thr576
Product name ARO-P11605-50
Uniprot ID A1A4S6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DKMGFTIIRKCISAVETRGINDQGLYRVVGVSSKVQRLLSMLMDVKTCNEVDLENSADWEVKTITSALKQYLRSLPEPLMTYELHGDFIVPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGPTLMRPQEETVAALMDLKFQNIVVEILIENHEKIFRT
Molecular weight 23.23 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp392-Thr576
Aliases /Synonyms Graf-related protein 2, GTPase regulator associated with focal adhesion kinase 2, ARHGAP10, GRAF2, Rho GTPase-activating protein 10, Rho-type GTPase-activating protein 10
Reference ARO-P11605
Note For research use only.
Molecular Constructor
Asp392–Thr576

Recombinant Human ARHGAP10 Protein: A Structural Overview

Recombinant Human ARHGAP10 Protein, also known as Rho GTPase-activating protein 10, is a human protein that plays a crucial role in regulating cell migration and adhesion. This protein is encoded by the ARHGAP10 gene and is a member of the RhoGAP family of proteins. In this article, we will provide a detailed description of the structure, activity, and applications of Recombinant Human ARHGAP10 Protein.

Structure of Recombinant Human ARHGAP10 Protein

The structure of Recombinant Human ARHGAP10 Protein consists of 1035 amino acids with a molecular weight of approximately 120 kDa. It contains a RhoGAP domain, a PH domain, and a C-terminal SH3 domain. The RhoGAP domain is responsible for the GTPase-activating activity of the protein, while the PH domain is involved in binding to phospholipids. The SH3 domain is responsible for protein-protein interactions.

The RhoGAP domain of Recombinant Human ARHGAP10 Protein has a conserved arginine finger motif, which is essential for its GTPase-activating activity. This domain interacts with the GTP-bound form of Rho proteins and stimulates their GTPase activity, leading to the conversion of active Rho-GTP to inactive Rho-GDP. This process plays a crucial role in regulating the activity of Rho proteins, which are involved in various cellular processes, including cell migration, adhesion, and cytoskeletal organization.

Activity of Recombinant Human ARHGAP10 Protein

Recombinant Human ARHGAP10 Protein has been shown to play a crucial role in regulating cell migration and adhesion. It acts as a negative regulator of Rho proteins, which are known to promote cell migration and adhesion. By stimulating the GTPase activity of Rho proteins, Recombinant Human ARHGAP10 Protein inhibits their activity, leading to the suppression of cell migration and adhesion.

In addition to its role in regulating Rho proteins, Recombinant Human ARHGAP10 Protein has also been shown to interact with other proteins involved in cell migration and adhesion. For example, it has been reported to interact with focal adhesion kinase (FAK) and p130Cas, which are key regulators of cell adhesion and migration. This interaction is thought to play a role in the regulation of focal adhesion turnover, which is crucial for cell migration.

Applications of Recombinant Human ARHGAP10 Protein

Recombinant Human ARHGAP10 Protein has been widely used in various research studies to investigate its role in cell migration and adhesion. It has also been used to study the regulation of Rho proteins and their downstream signaling pathways. In addition, Recombinant Human ARHGAP10 Protein has been used in cell-based assays to screen for potential inhibitors of its activity, which could have therapeutic potential for diseases involving abnormal cell migration, such as cancer.

Furthermore, Recombinant Human ARHGAP10 Protein has been used in structural studies to investigate its interaction with other proteins involved in cell migration and adhesion. These studies have provided valuable insights into the mechanism of action of this protein and its role in regulating cellular processes.

In conclusion, Recombinant Human ARHGAP10 Protein is a crucial protein involved in regulating cell migration and adhesion. Its structure, activity, and applications have been extensively studied, and it continues to be a subject of interest for researchers in the field of cell biology. With its potential therapeutic applications, Recombinant Human ARHGAP10 Protein holds great promise for the development of novel treatments for diseases involving abnormal cell migration and adhesion.

Recombinant Human ARHGAP10 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ARHGAP10 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products