Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ARNT/HIF1-beta Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P27540
Molecular weight:
24.69 kDa

Original price was: $264.00.Current price is: $230.00.

50ug 13% OFF + 230 loyalty points
Thr361–Val464
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ARNT/HIF1-beta Protein, N-His-SUMO

Product name ARO-P11204-100
Uniprot ID P27540
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNV
Molecular weight 24.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr361-Val464
Aliases /Synonyms ARNT, Dioxin receptor, nuclear translocator, ARNT protein, bHLHe2, BHLHE2, Aryl hydrocarbon receptor nuclear translocator, Hypoxia-inducible factor 1-beta, HIF1-beta, Class E basic helix-loop-helix protein 2, HIF-1-beta
Reference ARO-P11204
Note For research use only.
Molecular Constructor
Thr361–Val464
Product name ARO-P11204-1MG
Uniprot ID P27540
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNV
Molecular weight 24.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr361-Val464
Aliases /Synonyms ARNT, Dioxin receptor, nuclear translocator, ARNT protein, bHLHe2, BHLHE2, Aryl hydrocarbon receptor nuclear translocator, Hypoxia-inducible factor 1-beta, HIF1-beta, Class E basic helix-loop-helix protein 2, HIF-1-beta
Reference ARO-P11204
Note For research use only.
Molecular Constructor
Thr361–Val464
Product name ARO-P11204-50
Uniprot ID P27540
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNV
Molecular weight 24.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr361-Val464
Aliases /Synonyms ARNT, Dioxin receptor, nuclear translocator, ARNT protein, bHLHe2, BHLHE2, Aryl hydrocarbon receptor nuclear translocator, Hypoxia-inducible factor 1-beta, HIF1-beta, Class E basic helix-loop-helix protein 2, HIF-1-beta
Reference ARO-P11204
Note For research use only.
Molecular Constructor
Thr361–Val464

Introduction

Recombinant Human ARNT/HIF1-beta Protein, also known as Aryl Hydrocarbon Receptor Nuclear Translocator (ARNT) or Hypoxia-inducible Factor 1-beta (HIF1-beta), is a protein that plays a crucial role in cellular response to hypoxia, or low oxygen levels. It is a recombinant protein, meaning it is produced through genetic engineering techniques, and has a variety of functions and applications in the field of biotechnology and medicine.

Structure of Recombinant Human ARNT/HIF1-beta Protein

The ARNT/HIF1-beta protein is composed of 789 amino acids and has a molecular weight of approximately 91 kDa. It is a member of the basic-helix-loop-helix (bHLH)-Per-Arnt-Sim (PAS) family of transcription factors, which are known for their role in regulating gene expression in response to environmental signals. The protein contains several functional domains, including a bHLH domain, a PAS-A domain, a PAS-B domain, and a PAS-C domain.

The bHLH domain is responsible for DNA binding and dimerization with other bHLH-PAS proteins, while the PAS domains are involved in sensing and responding to environmental signals. The PAS-A domain is important for heterodimerization with the hypoxia-inducible factor 1-alpha (HIF1-alpha) protein, while the PAS-B and PAS-C domains are involved in binding to other transcription factors and coactivators.

Activity of Recombinant Human ARNT/HIF1-beta Protein

The primary function of ARNT/HIF1-beta protein is to act as a transcription factor, regulating the expression of genes involved in cellular responses to hypoxia. Under normal oxygen levels, the ARNT/HIF1-beta protein forms a heterodimer with the HIF1-alpha protein, which is rapidly degraded by the proteasome. However, under hypoxic conditions, the HIF1-alpha protein is stabilized and translocates to the nucleus, where it binds to the ARNT/HIF1-beta protein to form the active HIF1 transcription factor complex.

The HIF1 complex then binds to specific DNA sequences known as hypoxia response elements (HREs) in the promoters of target genes, leading to their upregulation. These target genes include those involved in angiogenesis, glycolysis, and erythropoiesis, which are all essential for cellular adaptation to low oxygen levels.

Application of Recombinant Human ARNT/HIF1-beta Protein

Due to its important role in regulating cellular responses to hypoxia, the ARNT/HIF1-beta protein has a wide range of applications in biotechnology and medicine. One of the most significant applications is in the development of therapeutics for diseases related to hypoxia, such as cancer and cardiovascular diseases.

For example, targeting the HIF1 complex with small molecule inhibitors can potentially inhibit the growth and survival of cancer cells, which often have a high demand for oxygen and nutrients. In addition, recombinant ARNT/HIF1-beta protein can be used in drug screening assays to identify potential HIF1 inhibitors or activators.

The ARNT/HIF1-beta protein also has potential applications in regenerative medicine, as it plays a critical role in the differentiation of stem cells into specific cell types under hypoxic conditions. By manipulating the activity of the HIF1 complex, researchers can control the differentiation of stem cells into various cell types, such as neurons or cardiomyocytes, for therapeutic purposes.

Conclusion

In summary, Recombinant Human ARNT/HIF1-beta Protein is a crucial protein involved in cellular responses to hypoxia. Its structure, activity, and applications make it a valuable tool in biotechnology and medicine. Further research on this protein and its interactions with other transcription factors may lead to the development of

Recombinant Human ARNT/HIF1-beta Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human ARNT/HIF1-beta Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products