Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ATP6V1D Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y5K8
Molecular weight:
30.43 kDa

Original price was: $353.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Met1–Glu247
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ATP6V1D Protein, N-His

Product name ARO-P11784-100
Uniprot ID Q9Y5K8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAEEKDEDLLFE
Molecular weight 30.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu247
Aliases /Synonyms ATP6M, V-ATPase subunit D, Vacuolar proton pump subunit D, VATD, ATP6V1D, V-type proton ATPase subunit D, V-ATPase 28 kDa accessory protein
Reference ARO-P11784
Note For research use only.
Molecular Constructor
Met1–Glu247
Product name ARO-P11784-1MG
Uniprot ID Q9Y5K8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAEEKDEDLLFE
Molecular weight 30.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu247
Aliases /Synonyms ATP6M, V-ATPase subunit D, Vacuolar proton pump subunit D, VATD, ATP6V1D, V-type proton ATPase subunit D, V-ATPase 28 kDa accessory protein
Reference ARO-P11784
Note For research use only.
Molecular Constructor
Met1–Glu247
Product name ARO-P11784-50
Uniprot ID Q9Y5K8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAEEKDEDLLFE
Molecular weight 30.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu247
Aliases /Synonyms ATP6M, V-ATPase subunit D, Vacuolar proton pump subunit D, VATD, ATP6V1D, V-type proton ATPase subunit D, V-ATPase 28 kDa accessory protein
Reference ARO-P11784
Note For research use only.
Molecular Constructor
Met1–Glu247

Introduction

Recombinant Human ATP6V1D Protein, also known as vacuolar ATP synthase subunit D, is a protein that plays a crucial role in the functioning of the vacuolar ATPase (V-ATPase) complex. This complex is responsible for maintaining the acidic environment in the lysosomes and endosomes of cells, which is essential for various cellular processes such as protein degradation, receptor recycling, and neurotransmitter release. The recombinant form of this protein has been extensively studied and has shown great potential in various applications. In this article, we will discuss the structure, activity, and applications of Recombinant Human ATP6V1D Protein in detail.

Structure of Recombinant Human ATP6V1D Protein

The human ATP6V1D gene is located on chromosome 17 and consists of 6 exons. The recombinant form of this protein is produced by cloning the gene into a suitable expression vector and expressing it in a host organism. The resulting protein is composed of 357 amino acids with a molecular weight of approximately 40 kDa. It contains a large N-terminal domain, a transmembrane domain, and a small C-terminal domain. The transmembrane domain is responsible for anchoring the protein to the membrane of the lysosomes and endosomes, while the N-terminal and C-terminal domains are involved in the interaction with other subunits of the V-ATPase complex.

Activity of Recombinant Human ATP6V1D Protein

The primary function of Recombinant Human ATP6V1D Protein is to act as a subunit of the V-ATPase complex. This complex is a multi-subunit enzyme that utilizes the energy from ATP hydrolysis to pump protons across the lysosomal and endosomal membranes, thereby creating an acidic environment. This acidification is essential for the proper functioning of lysosomal enzymes, which are responsible for degrading various cellular components. Additionally, the V-ATPase complex also plays a crucial role in receptor recycling, neurotransmitter release, and other cellular processes.

Applications of Recombinant Human ATP6V1D Protein

Recombinant Human ATP6V1D Protein has been widely used in various research applications. One of its primary applications is in the study of the V-ATPase complex and its role in cellular processes. The recombinant form of this protein can be used to study the structure and function of the complex, as well as its interactions with other subunits and regulatory factors.

Another application of Recombinant Human ATP6V1D Protein is in drug discovery and development. The V-ATPase complex has been identified as a potential target for various diseases, including cancer, osteoporosis, and neurodegenerative disorders. Recombinant Human ATP6V1D Protein can be used in high-throughput screening assays to identify small molecules that can modulate the activity of the V-ATPase complex, thereby providing potential leads for drug development.

Furthermore, Recombinant Human ATP6V1D Protein has also been used in the development of diagnostic assays. The presence of this protein in bodily fluids, such as blood, urine, and cerebrospinal fluid, has been linked to various diseases. Thus, detecting the levels of this protein can serve as a biomarker for disease diagnosis and monitoring.

Conclusion

In conclusion, Recombinant Human ATP6V1D Protein is a crucial subunit of the V-ATPase complex, responsible for maintaining the acidic environment in the lysosomes and endosomes of cells. Its recombinant form has been extensively studied and has shown great potential in various research, drug discovery, and diagnostic applications. With ongoing research and advancements in protein engineering, the use of Recombinant Human ATP6V1D Protein is expected to expand even further in the future.

Recombinant Human ATP6V1D Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ATP6V1D Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products