Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CIRBP Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q14011
Molecular weight:
22.66 kDa

Original price was: $389.00.Current price is: $327.00.

100ug 16% OFF + 327 loyalty points
Ala2–Gly83
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CIRBP Protein, N-His-SUMO & C-Strep

Product name ARO-P10750-100
Uniprot ID Q14011
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAG
Molecular weight 22.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Gly83
Aliases /Synonyms CIRBP, A18 hnRNP, CIRP, Glycine-rich RNA-binding protein CIRP, A18HNRNP, Cold-inducible RNA-binding protein
Reference ARO-P10750
Note For research use only.
Molecular Constructor
Ala2–Gly83
Product name ARO-P10750-1MG
Uniprot ID Q14011
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAG
Molecular weight 22.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Gly83
Aliases /Synonyms CIRBP, A18 hnRNP, CIRP, Glycine-rich RNA-binding protein CIRP, A18HNRNP, Cold-inducible RNA-binding protein
Reference ARO-P10750
Note For research use only.
Molecular Constructor
Ala2–Gly83
Product name ARO-P10750-50
Uniprot ID Q14011
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAG
Molecular weight 22.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Gly83
Aliases /Synonyms CIRBP, A18 hnRNP, CIRP, Glycine-rich RNA-binding protein CIRP, A18HNRNP, Cold-inducible RNA-binding protein
Reference ARO-P10750
Note For research use only.
Molecular Constructor
Ala2–Gly83

Introduction

Recombinant Human CIRBP Protein, also known as Cold-Inducible RNA-Binding Protein, is a highly conserved protein that plays a crucial role in cellular stress response and inflammation. It is a 20 kDa protein encoded by the CIRBP gene and is expressed in various tissues and cell types.

Structure of Recombinant Human CIRBP Protein

The structure of Recombinant Human CIRBP Protein consists of an RNA-binding domain (RBD) and a glycine-rich domain (GRD). The RBD is responsible for binding to specific RNA sequences, while the GRD is involved in protein-protein interactions. The protein also contains two nuclear localization signals, which allow it to shuttle between the nucleus and cytoplasm.

Activity of Recombinant Human CIRBP Protein

Recombinant Human CIRBP Protein is an RNA-binding protein that is activated in response to various stressors such as cold, hypoxia, and inflammation. It binds to specific RNA sequences and regulates their translation, stability, and subcellular localization. This activity is important for maintaining cellular homeostasis and promoting cell survival under stress conditions.

In addition to its role in RNA regulation, Recombinant Human CIRBP Protein also has chaperone-like activity. It can bind to unfolded proteins and prevent their aggregation, promoting their refolding and proper function. This activity is crucial for protecting cells from damage caused by stressors.

Applications of Recombinant Human CIRBP Protein

Recombinant Human CIRBP Protein has a wide range of applications in both research and medicine. Its ability to bind to specific RNA sequences makes it a valuable tool for studying post-transcriptional gene regulation. It can also be used to identify potential RNA targets and investigate their role in cellular processes.

In the medical field, Recombinant Human CIRBP Protein has potential therapeutic applications. Its role in inflammation and cellular stress response makes it a target for drug development in diseases such as cancer, neurodegenerative disorders, and cardiovascular diseases. It can also be used as a biomarker for monitoring disease progression and response to treatment.

Antigenic Properties of Recombinant Human CIRBP Protein

Recombinant Human CIRBP Protein is an antigen, meaning it can induce an immune response in the body. This property has been utilized in the development of diagnostic tests for autoimmune diseases such as systemic lupus erythematosus and rheumatoid arthritis. It can also be used as an antigen in vaccine development, particularly for diseases associated with inflammation and cellular stress.

Conclusion

In summary, Recombinant Human CIRBP Protein is a versatile protein with important roles in cellular stress response, inflammation, and RNA regulation. Its structure and activity make it a valuable tool for research and potential therapeutic applications. As our understanding of this protein continues to grow, it holds promise for further advancements in the fields of medicine and biotechnology.

Recombinant Human CIRBP Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human CIRBP Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products