Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RBM24 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BX46
Molecular weight:
22.51 kDa

Original price was: $422.00.Current price is: $327.00.

100ug 23% OFF + 327 loyalty points
Thr11–Lys91
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RBM24 Protein, N-His-SUMO & C-Strep

Product name ARO-P11756-100
Uniprot ID Q9BX46
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAK
Molecular weight 22.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr11-Lys91
Aliases /Synonyms RNA-binding region-containing protein 6, RNA-binding protein 24, RNA-binding motif protein 24, RBM24, RNPC6
Reference ARO-P11756
Note For research use only.
Molecular Constructor
Thr11–Lys91
Product name ARO-P11756-1MG
Uniprot ID Q9BX46
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAK
Molecular weight 22.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr11-Lys91
Aliases /Synonyms RNA-binding region-containing protein 6, RNA-binding protein 24, RNA-binding motif protein 24, RBM24, RNPC6
Reference ARO-P11756
Note For research use only.
Molecular Constructor
Thr11–Lys91
Product name ARO-P11756-50
Uniprot ID Q9BX46
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAK
Molecular weight 22.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr11-Lys91
Aliases /Synonyms RNA-binding region-containing protein 6, RNA-binding protein 24, RNA-binding motif protein 24, RBM24, RNPC6
Reference ARO-P11756
Note For research use only.
Molecular Constructor
Thr11–Lys91

Introduction to Recombinant Human RBM24 Protein

Recombinant Human RBM24 Protein, also known as RNA-binding motif protein 24, is a protein that is encoded by the RBM24 gene. This protein is a member of the RNA recognition motif (RRM) family and is involved in post-transcriptional regulation of gene expression. Recombinant Human RBM24 Protein is produced through recombinant DNA technology, making it a valuable tool in various fields of research and biotechnology.

Structure of Recombinant Human RBM24 Protein

The primary structure of Recombinant Human RBM24 Protein consists of 279 amino acids with a molecular weight of approximately 31.2 kDa. It contains one RRM domain, which is responsible for RNA binding, and a C-terminal region that is rich in arginine and serine residues. This unique structure allows Recombinant Human RBM24 Protein to interact with various RNA molecules and regulate their function.

The three-dimensional structure of Recombinant Human RBM24 Protein has been determined through X-ray crystallography and NMR spectroscopy. It adopts a beta-alpha-beta motif, with the RRM domain forming a beta-sheet and the C-terminal region forming an alpha-helix. This structure allows Recombinant Human RBM24 Protein to bind to specific RNA sequences and regulate their processing and translation.

Activity of Recombinant Human RBM24 Protein

Recombinant Human RBM24 Protein plays a crucial role in post-transcriptional regulation of gene expression. It binds to specific RNA molecules, including pre-mRNA, and regulates their splicing, polyadenylation, and translation. This activity is essential for the proper functioning of cells and is crucial in development and disease processes.

Studies have shown that Recombinant Human RBM24 Protein interacts with other proteins involved in RNA processing, such as splicing factors and poly(A) polymerases. This interaction allows for the coordinated regulation of RNA processing, ensuring the production of functional and stable RNA molecules.

Application of Recombinant Human RBM24 Protein

Recombinant Human RBM24 Protein has various applications in research and biotechnology. Its ability to regulate RNA processing makes it a valuable tool in studying gene expression and its dysregulation in diseases such as cancer and heart disease.

One of the major applications of Recombinant Human RBM24 Protein is in the production of recombinant proteins. It can be used as an antigen in protein expression systems to enhance the production and stability of recombinant proteins. This is due to its ability to bind to specific RNA sequences and regulate their translation, resulting in increased protein production.

Additionally, Recombinant Human RBM24 Protein has been used in the development of diagnostic assays for diseases such as leukemia and breast cancer. Its specific interaction with RNA molecules associated with these diseases makes it a valuable biomarker for their detection and monitoring.

Conclusion

In summary, Recombinant Human RBM24 Protein is a crucial player in post-transcriptional regulation of gene expression. Its unique structure and activity make it a valuable tool in various fields of research and biotechnology. Further studies on this protein and its interactions with other RNA-binding proteins will provide a better understanding of its role in cellular processes and its potential as a therapeutic target for diseases.

Recombinant Human RBM24 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human RBM24 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products