Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CRHR2 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13324
Molecular weight:
22.46 kDa

Original price was: $289.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
Glu20–Lys108
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CRHR2 Protein, N-His-SUMO

Product name ARO-P10753-100
Uniprot ID Q13324
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EELLLDGWGPPLDPEGPYSYCNTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRK
Molecular weight 22.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu20-Lys108
Aliases /Synonyms CRH-R-2, CRH2R, Corticotropin-releasing factor receptor 2, CRH-R2, CRHR2, CRF-R2, CRFR-2, CRF-R-2, CRF2R, Corticotropin-releasing hormone receptor 2
Reference ARO-P10753
Note For research use only.
Molecular Constructor
Glu20–Lys108
Product name ARO-P10753-1MG
Uniprot ID Q13324
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EELLLDGWGPPLDPEGPYSYCNTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRK
Molecular weight 22.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu20-Lys108
Aliases /Synonyms CRH-R-2, CRH2R, Corticotropin-releasing factor receptor 2, CRH-R2, CRHR2, CRF-R2, CRFR-2, CRF-R-2, CRF2R, Corticotropin-releasing hormone receptor 2
Reference ARO-P10753
Note For research use only.
Molecular Constructor
Glu20–Lys108
Product name ARO-P10753-50
Uniprot ID Q13324
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EELLLDGWGPPLDPEGPYSYCNTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRK
Molecular weight 22.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu20-Lys108
Aliases /Synonyms CRH-R-2, CRH2R, Corticotropin-releasing factor receptor 2, CRH-R2, CRHR2, CRF-R2, CRFR-2, CRF-R-2, CRF2R, Corticotropin-releasing hormone receptor 2
Reference ARO-P10753
Note For research use only.
Molecular Constructor
Glu20–Lys108

Introduction to Recombinant Human CRHR2 Protein

Recombinant Human CRHR2 Protein, also known as Corticotropin-Releasing Hormone Receptor 2, is a transmembrane protein that belongs to the G protein-coupled receptor (GPCR) family. It is encoded by the CRHR2 gene and is primarily expressed in the brain and pituitary gland. This protein plays a crucial role in the regulation of stress response and has been linked to various physiological and pathological conditions.

Structure of Recombinant Human CRHR2 Protein

The Recombinant Human CRHR2 Protein is composed of 411 amino acids and has a molecular weight of approximately 45 kDa. It consists of a large extracellular N-terminal domain, seven transmembrane helices, and a short C-terminal tail. The extracellular domain contains the binding site for its ligand, corticotropin-releasing hormone (CRH), while the transmembrane helices are responsible for signal transduction upon ligand binding.

The crystal structure of Recombinant Human CRHR2 Protein has been determined, revealing a similar overall structure to other GPCRs. However, it has unique structural features, such as an extended extracellular loop and a conserved disulfide bond, which are important for its specific binding and activation properties.

Activity of Recombinant Human CRHR2 Protein

The primary function of Recombinant Human CRHR2 Protein is to bind to its ligand, CRH, and initiate a signaling cascade that leads to the activation of various physiological responses. Upon binding, the CRHR2 protein undergoes a conformational change, which triggers the activation of G proteins and the subsequent activation of downstream signaling pathways, including the cAMP and MAPK pathways.

The activation of Recombinant Human CRHR2 Protein has been linked to the regulation of stress response, anxiety, depression, and other behavioral and physiological processes. It is also involved in the regulation of the immune and endocrine systems, as well as in the development and progression of various diseases, including cancer, cardiovascular diseases, and neurological disorders.

Application of Recombinant Human CRHR2 Protein

Due to its crucial role in various physiological and pathological processes, Recombinant Human CRHR2 Protein has been extensively studied and has potential applications in both research and therapeutic settings.

In research, Recombinant Human CRHR2 Protein is commonly used as an antigen in studies that aim to understand its structure, function, and signaling pathways. It is also used in drug discovery and development, as it is a promising target for the treatment of stress-related disorders and other diseases.

In therapeutic applications, Recombinant Human CRHR2 Protein can be used as a diagnostic tool for detecting and monitoring diseases that involve CRHR2 dysregulation. It can also be used as a therapeutic agent, either as a recombinant protein or as a target for drug development, to modulate CRHR2 activity and treat various diseases.

Conclusion

Recombinant Human CRHR2 Protein is a transmembrane protein that plays a crucial role in regulating stress response and is involved in various physiological and pathological processes. Its unique structure and activity make it a promising target for research and therapeutic applications. With further studies and developments, Recombinant Human CRHR2 Protein has the potential to contribute to the understanding and treatment of various diseases.

SDS-PAGE for Recombinant Human CRHR2 Protein, N-His-SUMO

SDS-PAGE for Recombinant Human CRHR2 Protein, N-His-SUMO

Recombinant Human CRHR2 Protein, N-His-SUMO, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Human CRHR2 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CRHR2 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products