Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human B4GALT6 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UBX8
Molecular weight:
32.93 kDa

Original price was: $280.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Glu125–Tyr382
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human B4GALT6 Protein, N-His

Product name ARO-P11173-100
Uniprot ID Q9UBX8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDSVWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYIDGLNNLIYRPKILVDRLYTNISVNLMPELAPIEDY
Molecular weight 32.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu125-Tyr382
Aliases /Synonyms b4Gal-T6, Beta4Gal-T6, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6, Beta-1,4-galactosyltransferase 6, Lactosylceramide synthase, UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase, Beta-1,4-GalTase 6, Glucosylceramide beta-1,4-galactosyltransferase, LacCer synthase, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6, B4GALT6
Reference ARO-P11173
Note For research use only.
Molecular Constructor
Glu125–Tyr382
Product name ARO-P11173-1MG
Uniprot ID Q9UBX8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDSVWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYIDGLNNLIYRPKILVDRLYTNISVNLMPELAPIEDY
Molecular weight 32.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu125-Tyr382
Aliases /Synonyms b4Gal-T6, Beta4Gal-T6, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6, Beta-1,4-galactosyltransferase 6, Lactosylceramide synthase, UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase, Beta-1,4-GalTase 6, Glucosylceramide beta-1,4-galactosyltransferase, LacCer synthase, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6, B4GALT6
Reference ARO-P11173
Note For research use only.
Molecular Constructor
Glu125–Tyr382
Product name ARO-P11173-50
Uniprot ID Q9UBX8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDSVWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYIDGLNNLIYRPKILVDRLYTNISVNLMPELAPIEDY
Molecular weight 32.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu125-Tyr382
Aliases /Synonyms b4Gal-T6, Beta4Gal-T6, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6, Beta-1,4-galactosyltransferase 6, Lactosylceramide synthase, UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase, Beta-1,4-GalTase 6, Glucosylceramide beta-1,4-galactosyltransferase, LacCer synthase, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6, B4GALT6
Reference ARO-P11173
Note For research use only.
Molecular Constructor
Glu125–Tyr382

Introduction

Recombinant Human B4GALT6 Protein, also known as beta-1,4-galactosyltransferase 6, is a glycosyltransferase enzyme that plays a crucial role in the biosynthesis of complex glycoproteins. This protein is encoded by the B4GALT6 gene, located on chromosome 9 in humans. Recombinant Human B4GALT6 Protein is widely used in various research and industrial applications due to its unique structure and function.

Structure of Recombinant Human B4GALT6 Protein

Recombinant Human B4GALT6 Protein is a type II transmembrane protein with a molecular weight of approximately 44 kDa. It is composed of 397 amino acids and contains a signal peptide, a catalytic domain, and a transmembrane domain. The catalytic domain of this protein is responsible for its enzymatic activity, while the transmembrane domain anchors it to the cell membrane.

Activity of Recombinant Human B4GALT6 Protein

Recombinant Human B4GALT6 Protein is a glycosyltransferase enzyme that catalyzes the transfer of galactose from UDP-galactose to N-acetylglucosamine (GlcNAc) residues on glycoproteins. This process, known as galactosylation, is essential for the biosynthesis of complex glycoproteins, which are involved in various biological processes such as cell adhesion, signaling, and immune response.

The activity of Recombinant Human B4GALT6 Protein has been extensively studied and has been found to be crucial for the proper functioning of many important proteins, including integrins, immunoglobulins, and growth factor receptors. It also plays a role in the biosynthesis of glycolipids, which are important components of cell membranes.

Application of Recombinant Human B4GALT6 Protein

Recombinant Human B4GALT6 Protein has a wide range of applications in both research and industrial settings. Its ability to catalyze the galactosylation of glycoproteins makes it a valuable tool for studying the role of glycosylation in various biological processes. It is also used in the production of recombinant glycoproteins, where it can be used to modify the glycosylation pattern of the protein of interest.

In the field of immunology, Recombinant Human B4GALT6 Protein is used as an antigen to generate antibodies that can specifically recognize and bind to this protein. These antibodies are used in various immunoassays, such as ELISA and Western blot, to detect the presence of this protein in biological samples.

Recombinant Human B4GALT6 Protein also has industrial applications, particularly in the production of therapeutic glycoproteins. The modification of glycosylation patterns by this protein can improve the stability, efficacy, and immunogenicity of therapeutic proteins, making them more suitable for clinical use.

Conclusion

In summary, Recombinant Human B4GALT6 Protein is a crucial enzyme involved in the biosynthesis of complex glycoproteins. Its unique structure and activity make it a valuable tool in various research and industrial applications. As our understanding of the role of glycosylation in biological processes continues to grow, the importance of Recombinant Human B4GALT6 Protein in these applications will only increase.

Recombinant Human B4GALT6 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human B4GALT6 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products