Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human BCAS2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O75934
Molecular weight:
28.29 kDa

Original price was: $274.00.Current price is: $230.00.

50ug 16% OFF + 230 loyalty points
Met1–Phe225
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human BCAS2 Protein, N-His

Product name ARO-P11900-100
Uniprot ID O75934
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
Molecular weight 28.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe225
Aliases /Synonyms DNA amplified in mammary carcinoma 1 protein, BCAS2, DAM1, Breast carcinoma-amplified sequence 2, Pre-mRNA-splicing factor SPF27, Spliceosome-associated protein SPF 27
Reference ARO-P11900
Note For research use only.
Molecular Constructor
Met1–Phe225
Product name ARO-P11900-1MG
Uniprot ID O75934
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
Molecular weight 28.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe225
Aliases /Synonyms DNA amplified in mammary carcinoma 1 protein, BCAS2, DAM1, Breast carcinoma-amplified sequence 2, Pre-mRNA-splicing factor SPF27, Spliceosome-associated protein SPF 27
Reference ARO-P11900
Note For research use only.
Molecular Constructor
Met1–Phe225
Product name ARO-P11900-50
Uniprot ID O75934
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
Molecular weight 28.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe225
Aliases /Synonyms DNA amplified in mammary carcinoma 1 protein, BCAS2, DAM1, Breast carcinoma-amplified sequence 2, Pre-mRNA-splicing factor SPF27, Spliceosome-associated protein SPF 27
Reference ARO-P11900
Note For research use only.
Molecular Constructor
Met1–Phe225

Introduction

Recombinant Human BCAS2 Protein is a type of protein that is produced through the use of recombinant DNA technology. This protein plays an important role in various biological processes and has potential applications in various fields such as medicine and biotechnology.

Structure of Recombinant Human BCAS2 Protein

The recombinant Human BCAS2 Protein is a 63-kDa protein that is composed of 561 amino acids. It is a member of the breast carcinoma amplified sequence (BCAS) family of proteins and is highly conserved across different species. The protein has a unique structure that consists of an N-terminal region, a central coiled-coil domain, and a C-terminal region. The central coiled-coil domain is essential for the protein’s function and is responsible for its dimerization.

Activity of Recombinant Human BCAS2 Protein

Recombinant Human BCAS2 Protein plays a crucial role in various biological processes such as cell proliferation, differentiation, and migration. It is also involved in the regulation of gene expression and is known to interact with several transcription factors. The protein has been shown to have a role in the development of various types of cancer, including breast, lung, and prostate cancer. It has also been linked to the progression and metastasis of these cancers.

One of the key functions of Recombinant Human BCAS2 Protein is its involvement in the regulation of the estrogen receptor (ER) signaling pathway. The protein interacts with the ER and modulates its activity, thereby affecting the expression of estrogen-responsive genes. This makes it a potential target for the treatment of ER-positive breast cancer.

Application of Recombinant Human BCAS2 Protein

Recombinant Human BCAS2 Protein has potential applications in various fields, including medicine and biotechnology. Some of the key applications of this protein are discussed below.

1. Cancer Research: As mentioned earlier, Recombinant Human BCAS2 Protein has been linked to the development and progression of various types of cancer. Therefore, it can be used as a biomarker for the early detection and diagnosis of cancer. It can also serve as a potential therapeutic target for the treatment of cancer.

2. Drug Development: The involvement of Recombinant Human BCAS2 Protein in the regulation of the ER signaling pathway makes it a potential target for developing novel drugs for the treatment of ER-positive breast cancer. In addition, the protein’s role in other biological processes makes it a potential target for drug development in other diseases.

3. Biotechnology: Recombinant Human BCAS2 Protein can be produced in large quantities using recombinant DNA technology, making it a valuable tool in biotechnology. It can be used for various applications, such as protein-protein interaction studies, protein purification, and protein engineering.

4. Diagnostic Tool: The protein’s involvement in the regulation of gene expression and its association with various types of cancer make it a potential diagnostic tool. It can be used to detect the presence of cancer and monitor the progression of the disease.

Conclusion

In conclusion, Recombinant Human BCAS2 Protein is a 63-kDa protein that plays a crucial role in various biological processes, including cell proliferation, differentiation, and migration. It is also involved in the regulation of gene expression and has been linked to the development and progression of various types of cancer. This protein has potential applications in cancer research, drug development, biotechnology, and as a diagnostic tool. Further research on this protein can provide valuable insights into its structure and function, leading to the development of new treatments for various diseases.

Recombinant Human BCAS2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human BCAS2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products