Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CCPG1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9ULG6
Molecular weight:
16.27 kDa

Original price was: $271.00.Current price is: $230.00.

50ug 15% OFF + 230 loyalty points
Asn621–Gly735
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CCPG1 Protein, N-His

Product name ARO-P10656-100
Uniprot ID Q9ULG6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NSHSFRKACSGVFDCAQQESMSLFNTVVNPIRMDEFRQIIQRYMLKELDTFCHWNELDQFINKFFLNGVFIHDQKLFTDFVNDVKDYLRNMKEYEVDNDGVFEKLDEYIYRHFFG
Molecular weight 16.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn621-Gly735
Aliases /Synonyms Cell cycle progression restoration protein 8, CCPG1, CPR8, CCP8, KIAA1254, Cell cycle progression protein 1
Reference ARO-P10656
Note For research use only.
Molecular Constructor
Asn621–Gly735
Product name ARO-P10656-1MG
Uniprot ID Q9ULG6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NSHSFRKACSGVFDCAQQESMSLFNTVVNPIRMDEFRQIIQRYMLKELDTFCHWNELDQFINKFFLNGVFIHDQKLFTDFVNDVKDYLRNMKEYEVDNDGVFEKLDEYIYRHFFG
Molecular weight 16.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn621-Gly735
Aliases /Synonyms Cell cycle progression restoration protein 8, CCPG1, CPR8, CCP8, KIAA1254, Cell cycle progression protein 1
Reference ARO-P10656
Note For research use only.
Molecular Constructor
Asn621–Gly735
Product name ARO-P10656-50
Uniprot ID Q9ULG6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NSHSFRKACSGVFDCAQQESMSLFNTVVNPIRMDEFRQIIQRYMLKELDTFCHWNELDQFINKFFLNGVFIHDQKLFTDFVNDVKDYLRNMKEYEVDNDGVFEKLDEYIYRHFFG
Molecular weight 16.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn621-Gly735
Aliases /Synonyms Cell cycle progression restoration protein 8, CCPG1, CPR8, CCP8, KIAA1254, Cell cycle progression protein 1
Reference ARO-P10656
Note For research use only.
Molecular Constructor
Asn621–Gly735

Introduction to Recombinant Human CCPG1 Protein

Recombinant Human CCPG1 Protein, also known as Cell Cycle Progression Gene 1 Protein, is a human protein that plays a crucial role in cell cycle regulation and progression. This protein is encoded by the CCPG1 gene and is involved in the G1/S phase transition of the cell cycle. Recombinant Human CCPG1 Protein is produced through genetic engineering techniques, making it a valuable tool for research and biotechnological applications.

Structure of Recombinant Human CCPG1 Protein

Recombinant Human CCPG1 Protein is a 78 kDa protein composed of 703 amino acids. It contains a conserved N-terminal domain, a central coiled-coil domain, and a C-terminal domain. The N-terminal domain is responsible for protein-protein interactions, while the coiled-coil domain is involved in dimerization and oligomerization. The C-terminal domain contains a cyclin-binding motif, which is essential for the protein’s role in cell cycle regulation.

Activity of Recombinant Human CCPG1 Protein

Recombinant Human CCPG1 Protein is a key regulator of the G1/S phase transition in the cell cycle. It interacts with cyclin D1 and CDK4, promoting their binding and activation. This, in turn, leads to the phosphorylation of retinoblastoma protein (RB), releasing it from its inhibitory state and allowing the cell to progress from the G1 phase to the S phase. Recombinant Human CCPG1 Protein also plays a role in DNA damage response, promoting cell survival and repair mechanisms.

Application of Recombinant Human CCPG1 Protein

1. Cell Cycle Research: Recombinant Human CCPG1 Protein is widely used in cell cycle research to study its role in G1/S phase transition and its interactions with other cell cycle regulators. It is also used to investigate the effects of CCPG1 mutations on cell cycle regulation and progression.

2. Cancer Research: Aberrant cell cycle regulation is a hallmark of cancer, and Recombinant Human CCPG1 Protein has been shown to be dysregulated in various types of cancer. Its role in promoting cell survival and DNA damage response makes it a potential target for cancer therapy.

3. Drug Development: The dysregulation of the cell cycle is a common feature of many diseases, making Recombinant Human CCPG1 Protein a potential target for drug development. Researchers can use this protein to screen for compounds that can modulate its activity and potentially treat diseases associated with cell cycle dysfunction.

4. Diagnostic Tool: Recombinant Human CCPG1 Protein can also be used as a diagnostic tool for certain types of cancer. Its dysregulation has been observed in various cancer types, and its levels can be measured in patient samples to aid in diagnosis and prognosis.

5. Vaccine Development: Recombinant Human CCPG1 Protein has been identified as an antigen in several studies, making it a potential candidate for vaccine development. Its involvement in the cell cycle and DNA damage response suggests that it may play a role in immune response, making it a valuable target for vaccine development against diseases such as cancer.

Conclusion

Recombinant Human CCPG1 Protein is a crucial player in cell cycle regulation and progression. Its structure, activity, and potential applications make it a valuable tool for research and biotechnological purposes. Further studies on this protein may provide insights into its role in disease and open up new avenues for therapeutic interventions.

Recombinant Human CCPG1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CCPG1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products