Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ZC3H4 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UPT8
Molecular weight:
38.12 kDa

Original price was: $280.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Glu417–Gly503
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ZC3H4 Protein, N-GST & C-His

Product name ARO-P12169-100
Uniprot ID Q9UPT8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ELPKKRELCKFYITGFCARAENCPYMHGDFPCKLYHTTGNCINGDDCMFSHDPLTEETRELLDKMLADDAEAGAEDEKEVEELKKQG
Molecular weight 38.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu417-Gly503
Aliases /Synonyms KIAA1064, C19orf7, ZC3H4, Zinc finger CCCH domain-containing protein 4
Reference ARO-P12169
Note For research use only.
Molecular Constructor
Glu417–Gly503
Product name ARO-P12169-1MG
Uniprot ID Q9UPT8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ELPKKRELCKFYITGFCARAENCPYMHGDFPCKLYHTTGNCINGDDCMFSHDPLTEETRELLDKMLADDAEAGAEDEKEVEELKKQG
Molecular weight 38.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu417-Gly503
Aliases /Synonyms KIAA1064, C19orf7, ZC3H4, Zinc finger CCCH domain-containing protein 4
Reference ARO-P12169
Note For research use only.
Molecular Constructor
Glu417–Gly503
Product name ARO-P12169-50
Uniprot ID Q9UPT8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ELPKKRELCKFYITGFCARAENCPYMHGDFPCKLYHTTGNCINGDDCMFSHDPLTEETRELLDKMLADDAEAGAEDEKEVEELKKQG
Molecular weight 38.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu417-Gly503
Aliases /Synonyms KIAA1064, C19orf7, ZC3H4, Zinc finger CCCH domain-containing protein 4
Reference ARO-P12169
Note For research use only.
Molecular Constructor
Glu417–Gly503

Introduction

Recombinant Human ZC3H4 Protein is a type of protein that is produced in a laboratory setting through the process of genetic engineering. It is a highly specific and pure form of the ZC3H4 protein, which is naturally found in humans. This recombinant protein has a wide range of applications in the field of biomedical research and medicine. In this article, we will explore the structure, activity, and various applications of Recombinant Human ZC3H4 Protein.

Structure of Recombinant Human ZC3H4 Protein

The ZC3H4 protein is a zinc finger protein that is encoded by the ZC3H4 gene. It is composed of 298 amino acids and has a molecular weight of approximately 33 kDa. The recombinant form of this protein is produced by inserting the ZC3H4 gene into a suitable expression vector and then introducing it into a host cell, such as bacteria or yeast. The host cell then produces large quantities of the recombinant protein, which can be purified and used for various applications.

The recombinant form of ZC3H4 protein has the same amino acid sequence as the natural form, making it highly specific and biologically active. It also contains a zinc finger domain, which is a conserved protein motif that is involved in DNA binding and protein-protein interactions. This domain plays a crucial role in the activity of ZC3H4 protein.

Activity of Recombinant Human ZC3H4 Protein

The main function of ZC3H4 protein is to regulate gene expression. It does so by binding to specific DNA sequences and recruiting other proteins to form a complex that either activates or represses gene transcription. This activity is essential for the proper functioning of cells and is involved in various cellular processes such as cell growth, differentiation, and apoptosis.

In addition to its role in gene regulation, ZC3H4 protein has also been shown to interact with other proteins involved in RNA processing and translation. This suggests that it may have a broader role in cellular functions beyond gene expression.

Applications of Recombinant Human ZC3H4 Protein

Recombinant Human ZC3H4 Protein has a wide range of applications in biomedical research and medicine. Its ability to regulate gene expression makes it a valuable tool for studying the function of specific genes and their role in various diseases. It can also be used to investigate the mechanisms of gene regulation and the interactions between proteins involved in this process.

One of the most significant applications of recombinant ZC3H4 protein is in the development of therapeutic interventions for diseases. Its role in gene regulation makes it a potential target for drug development, and studies have shown that manipulating ZC3H4 activity can have a significant impact on the progression of certain diseases.

Furthermore, recombinant ZC3H4 protein can also be used as an antigen for the production of antibodies. These antibodies can then be used for various research and diagnostic purposes, such as detecting the presence of ZC3H4 protein in cells or tissues.

Conclusion

In conclusion, Recombinant Human ZC3H4 Protein is a highly specific and biologically active form of the ZC3H4 protein, produced through genetic engineering. Its structure, activity, and various applications make it a valuable tool in biomedical research and medicine. With its role in gene regulation and potential as a therapeutic target, this recombinant protein holds great promise for future advancements in the field of biotechnology.

Recombinant Human ZC3H4 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human ZC3H4 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products