Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD301/CLEC10A, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8IUN9
Molecular weight:
21.30 kDa

Original price was: $274.00.Current price is: $230.00.

50ug 16% OFF + 230 loyalty points
Thr71–Met239
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD301/CLEC10A, N-His

Product name ARO-P13260-100
Uniprot ID Q8IUN9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWM
Molecular weight 21.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr71-Met239
Aliases /Synonyms CD301, Macrophage lectin 2, C-type lectin domain family 10 member A, CLECSF13, C-type lectin superfamily member 14, CLEC10A, CLECSF14, HML
Reference ARO-P13260
Note For research use only.
Molecular Constructor
Thr71–Met239
Product name ARO-P13260-1MG
Uniprot ID Q8IUN9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWM
Molecular weight 21.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr71-Met239
Aliases /Synonyms CD301, Macrophage lectin 2, C-type lectin domain family 10 member A, CLECSF13, C-type lectin superfamily member 14, CLEC10A, CLECSF14, HML
Reference ARO-P13260
Note For research use only.
Molecular Constructor
Thr71–Met239
Product name ARO-P13260-50
Uniprot ID Q8IUN9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWM
Molecular weight 21.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr71-Met239
Aliases /Synonyms CD301, Macrophage lectin 2, C-type lectin domain family 10 member A, CLECSF13, C-type lectin superfamily member 14, CLEC10A, CLECSF14, HML
Reference ARO-P13260
Note For research use only.
Molecular Constructor
Thr71–Met239

Introduction

Recombinant Human CD301/CLEC10A, also known as C-type lectin domain family 10 member A, is a type II transmembrane protein that belongs to the C-type lectin superfamily. It is encoded by the CLEC10A gene and is expressed on the surface of dendritic cells, macrophages, and certain subsets of B cells. This protein plays a crucial role in immune response and has been extensively studied for its potential applications in immunotherapy and vaccine development.

Structure of Recombinant Human CD301/CLEC10A

Recombinant Human CD301/CLEC10A is composed of 247 amino acids and has a predicted molecular weight of approximately 28 kDa. It consists of a single C-type lectin domain, a stalk region, a transmembrane domain, and a short cytoplasmic tail. The C-type lectin domain is responsible for binding to specific carbohydrate structures, while the stalk region and transmembrane domain anchor the protein to the cell membrane. The cytoplasmic tail contains a conserved signaling motif, which is involved in intracellular signal transduction.

Activity of Recombinant Human CD301/CLEC10A

Recombinant Human CD301/CLEC10A is a type II transmembrane protein that acts as a pattern recognition receptor (PRR) on the surface of immune cells. It recognizes and binds to specific carbohydrate structures, such as mannose and fucose, on the surface of pathogens and damaged cells. This binding triggers a signaling cascade that activates the immune response, leading to the elimination of the pathogen or damaged cells.

In addition to its role as a PRR, Recombinant Human CD301/CLEC10A also has immunoregulatory functions. It has been shown to modulate the function of dendritic cells, promoting their maturation and activation. This results in the production of pro-inflammatory cytokines and chemokines, which recruit and activate other immune cells to the site of infection or injury.

Application of Recombinant Human CD301/CLEC10A

Recombinant Human CD301/CLEC10A has several potential applications in the field of immunotherapy and vaccine development. Its ability to recognize and bind to specific carbohydrate structures on pathogens makes it a promising candidate for the development of vaccines against infectious diseases. By targeting these specific structures, the vaccine can induce a strong immune response and provide protection against the pathogen.

In addition, Recombinant Human CD301/CLEC10A has been studied for its potential use in cancer immunotherapy. It has been shown to be highly expressed on the surface of tumor-associated macrophages, which play a crucial role in the growth and progression of tumors. By targeting these macrophages with Recombinant Human CD301/CLEC10A, it is possible to modulate their function and inhibit tumor growth.

Moreover, Recombinant Human CD301/CLEC10A has been investigated as a potential adjuvant in vaccine development. Adjuvants are substances that are added to vaccines to enhance their immunogenicity. Studies have shown that Recombinant Human CD301/CLEC10A can enhance the immune response to various antigens, making it a promising candidate for use as an adjuvant in vaccines.

Conclusion

Recombinant Human CD301/CLEC10A is a type II transmembrane protein that plays a crucial role in immune response. Its structure, activity, and potential applications make it a promising candidate for the development of vaccines and immunotherapies. Further research on this protein may lead to the development of novel treatments for infectious diseases and cancer.

Recombinant Human CD301/CLEC10A, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CD301/CLEC10A, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products