Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CNRIP1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96F85
Molecular weight:
17.35 kDa

Original price was: $326.00.Current price is: $274.00.

50ug 16% OFF + 274 loyalty points
Gln34–Leu164
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CNRIP1, N-His

Product name ARO-P13181-100
Uniprot ID Q96F85
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESF
Molecular weight 17.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln34-Leu164
Aliases /Synonyms CNRIP1, C2orf32, CB1 cannabinoid receptor-interacting protein 1, CRIP-1
Reference ARO-P13181
Note For research use only.
Molecular Constructor
Gln34–Leu164
Product name ARO-P13181-1MG
Uniprot ID Q96F85
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESF
Molecular weight 17.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln34-Leu164
Aliases /Synonyms CNRIP1, C2orf32, CB1 cannabinoid receptor-interacting protein 1, CRIP-1
Reference ARO-P13181
Note For research use only.
Molecular Constructor
Gln34–Leu164
Product name ARO-P13181-50
Uniprot ID Q96F85
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESF
Molecular weight 17.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln34-Leu164
Aliases /Synonyms CNRIP1, C2orf32, CB1 cannabinoid receptor-interacting protein 1, CRIP-1
Reference ARO-P13181
Note For research use only.
Molecular Constructor
Gln34–Leu164

Title: Introduction to Recombinant Human CNRIP1
Recombinant Human CNRIP1: A Powerful Tool in Biomedical Research
Recombinant Protein Production and Structure of CNRIP1
The Role of Recombinant Human CNRIP1 in Cellular Activity
Applications of Recombinant Human CNRIP1 in Disease Research

Introduction to Recombinant Human CNRIP1

Recombinant Human CNRIP1, also known as cannabinoid receptor interacting protein 1, is a protein that is encoded by the CNRIP1 gene. This protein is found in humans and is involved in various cellular processes, including the regulation of cannabinoid receptors. CNRIP1 has been extensively studied in recent years due to its potential role in disease development and therapeutic applications.

Recombinant Human CNRIP1: A Powerful Tool in Biomedical Research

Recombinant proteins, including Recombinant Human CNRIP1, have become an essential tool in biomedical research. These proteins are produced in a laboratory setting using genetic engineering techniques, allowing for the production of large quantities of pure and highly specific proteins. Recombinant Human CNRIP1 has been used in various studies to understand its structure, function, and potential applications.

Recombinant Protein Production and Structure of CNRIP1

Recombinant Human CNRIP1 is produced by inserting the CNRIP1 gene into a suitable expression system, such as bacteria, yeast, or mammalian cells. The recombinant protein is then purified using various techniques, including chromatography and electrophoresis, to obtain a highly pure and active form of CNRIP1.

The structure of Recombinant Human CNRIP1 has been extensively studied using techniques such as X-ray crystallography and nuclear magnetic resonance (NMR) spectroscopy. These studies have revealed that CNRIP1 is a multi-domain protein, with an N-terminal domain containing a coiled-coil structure and a C-terminal domain containing a PDZ domain. The PDZ domain is known to interact with various proteins, including cannabinoid receptors, suggesting a potential role for CNRIP1 in regulating their activity.

The Role of Recombinant Human CNRIP1 in Cellular Activity

CNRIP1 has been shown to play a role in various cellular processes, including the regulation of cannabinoid receptors. Studies have demonstrated that CNRIP1 interacts with cannabinoid receptors, specifically CB1 and CB2, and modulates their activity. This interaction has been shown to affect the signaling pathways involved in pain, inflammation, and neuroprotection.

Furthermore, CNRIP1 has also been implicated in the regulation of glucose and lipid metabolism, making it a potential target for the treatment of metabolic disorders such as obesity and type 2 diabetes. Additionally, CNRIP1 has been shown to play a role in cell proliferation and differentiation, suggesting its involvement in cancer development and progression.

Applications of Recombinant Human CNRIP1 in Disease Research

The potential role of CNRIP1 in various cellular processes makes it a promising target for disease research and therapeutic interventions. Recombinant Human CNRIP1 has been used in studies to understand its involvement in diseases such as chronic pain, neurodegenerative disorders, and metabolic diseases.

In addition, the use of CNRIP1 in drug discovery and development has been explored, with several studies showing its potential as a target for novel therapeutics. Recombinant Human CNRIP1 has also been used in diagnostic assays to detect the presence of CNRIP1 in various diseases, providing a potential biomarker for disease diagnosis and monitoring.

Conclusion

In conclusion, Recombinant Human CNRIP1 is a powerful tool in biomedical research, with its potential role in regulating cellular activity and its involvement in various diseases. The production and study of this protein have provided valuable insights into its structure, function, and potential therapeutic applications. Further research on CNRIP1 and its interactions with other proteins and signaling pathways may lead to the development of novel treatments for various diseases.

Recombinant Human CNRIP1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CNRIP1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products