Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DBP Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q10586
Molecular weight:
17.90 kDa

Original price was: $343.00.Current price is: $274.00.

50ug 20% OFF + 274 loyalty points
Pro193–Leu325
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DBP Protein, N-His

Product name ARO-P10756-100
Uniprot ID Q10586
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGAL
Molecular weight 17.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro193-Leu325
Aliases /Synonyms Albumin D box-binding protein, TaxREB302, Tax-responsive enhancer element-binding protein 302, D site-binding protein, DBP, Albumin D-element-binding protein
Reference ARO-P10756
Note For research use only.
Molecular Constructor
Pro193–Leu325
Product name ARO-P10756-1MG
Uniprot ID Q10586
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGAL
Molecular weight 17.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro193-Leu325
Aliases /Synonyms Albumin D box-binding protein, TaxREB302, Tax-responsive enhancer element-binding protein 302, D site-binding protein, DBP, Albumin D-element-binding protein
Reference ARO-P10756
Note For research use only.
Molecular Constructor
Pro193–Leu325
Product name ARO-P10756-50
Uniprot ID Q10586
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGAL
Molecular weight 17.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro193-Leu325
Aliases /Synonyms Albumin D box-binding protein, TaxREB302, Tax-responsive enhancer element-binding protein 302, D site-binding protein, DBP, Albumin D-element-binding protein
Reference ARO-P10756
Note For research use only.
Molecular Constructor
Pro193–Leu325

Introduction to Recombinant Human DBP Protein

Recombinant Human DBP Protein, also known as Vitamin D Binding Protein, is a glycoprotein that plays a crucial role in the transport of vitamin D and its metabolites in the blood. It is encoded by the GC gene and is primarily synthesized in the liver. This protein has been extensively studied and has shown to have various structural and functional properties that make it a valuable tool in the field of biotechnology and medicine. In this article, we will explore the structure, activity, and applications of Recombinant Human DBP Protein.

Structure of Recombinant Human DBP Protein

Recombinant Human DBP Protein is a single-chain polypeptide with a molecular weight of approximately 52 kDa. It consists of 458 amino acids and has a three-dimensional structure that is composed of multiple domains. The protein has a globular shape and is composed of three distinct domains – the N-terminal domain, the central domain, and the C-terminal domain.

The N-terminal domain is responsible for the binding of vitamin D and its metabolites, while the central domain is involved in the binding of fatty acids. The C-terminal domain, on the other hand, plays a crucial role in the binding of actin and other proteins. The structure of Recombinant Human DBP Protein is highly conserved among different species, indicating its importance in biological processes.

Activity of Recombinant Human DBP Protein

Recombinant Human DBP Protein is primarily known for its role in the transport of vitamin D and its metabolites in the blood. It binds to these molecules with high affinity and protects them from degradation, thereby increasing their half-life in the circulation. This protein also has a role in regulating the levels of free vitamin D in the blood, which is essential for maintaining calcium homeostasis and bone health.

In addition to its role in vitamin D transport, Recombinant Human DBP Protein has been shown to have immunomodulatory properties. It has been found to interact with various immune cells and modulate their functions, such as T cell proliferation and cytokine production. This suggests that this protein may have a role in regulating immune responses and could be a potential target for immunotherapeutic interventions.

Applications of Recombinant Human DBP Protein

Recombinant Human DBP Protein has a wide range of applications in both research and medicine. Its ability to bind to vitamin D and its metabolites with high affinity makes it a valuable tool for studying the metabolism and transport of this essential vitamin. It is also used in diagnostic assays to measure vitamin D levels in the blood.

Furthermore, Recombinant Human DBP Protein has been investigated as a potential therapeutic agent for various diseases. Its immunomodulatory properties make it a promising candidate for the treatment of autoimmune disorders, such as multiple sclerosis and rheumatoid arthritis. It has also been studied for its potential role in cancer therapy, as it has been found to inhibit tumor growth and induce cell death in cancer cells.

In conclusion, Recombinant Human DBP Protein is a versatile protein with a well-defined structure and diverse biological activities. Its role in vitamin D transport and immunomodulation make it a valuable tool for research and potential therapeutic applications. With ongoing studies and advancements in biotechnology, the potential of this protein is yet to be fully explored, and it holds great promise for the future of medicine.

Recombinant Human DBP Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DBP Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products